PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.192190.1
Common NameCsa_3G651860, LOC101205529
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family GRF
Protein Properties Length: 344aa    MW: 38283.3 Da    PI: 7.5405
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.192190.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC79.33.6e-2576119144
             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                     d+epgrCrRtDGKkWRCs+++++++k+CErH+hrgr+rsrk++e
  Cucsa.192190.1  76 DPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVE 119
                     79***************************************997 PP

2QLQ59.87.7e-211045136
             QLQ  1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36
                    s+FTa+Q+q+L++Q+l++K++++++P+Pp+L++ ++
  Cucsa.192190.1 10 SPFTATQWQELEHQALIFKHMVSGVPIPPDLIFSVK 45
                    89******************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009512.4E-121046IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166621.9611146IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088803.4E-151144IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.94176120IPR014977WRC domain
PfamPF088793.1E-2177119IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009739Biological Processresponse to gibberellin
GO:0030912Biological Processresponse to deep water
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MNSSPKTCTS PFTATQWQEL EHQALIFKHM VSGVPIPPDL IFSVKRSLDS SISARLFPHQ  60
PIGWGCFEMG FGRKTDPEPG RCRRTDGKKW RCSKEAYPDS KYCERHMHRG RNRSRKPVEI  120
SSTPPIQTPT PLILTSTRTL SSSSSTPTSS SYPLSTLSSS SSSLTSETQS YHQPPPPAYH  180
ESSIHPFLYS QSSSRTPCSD FSSNITNPQL FLYSGTHSQS DKDYRDISGS REGVGMQAFF  240
PSVADSARSI AEVYSQPIGM DSYKGCSQYV SQNHQIYSSK QARQQQEQHC FVLGTDFNKS  300
SRSAKTEEED EDAETQKPLL HFFEDCPPKS SDSWLDLASN SNG*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN7132580.0LN713258.1 Cucumis melo genomic chromosome, chr_4.
GenBankLN6818280.0LN681828.1 Cucumis melo genomic scaffold, anchoredscaffold00083.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011651737.10.0PREDICTED: growth-regulating factor 5-like isoform X2
TrEMBLA0A0A0LCW40.0A0A0A0LCW4_CUCSA; Uncharacterized protein
STRINGGLYMA07G04290.11e-118(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF97443137
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.12e-64growth-regulating factor 5
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]