PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.158540.1
Common NameCsa_5G633830
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family LBD
Protein Properties Length: 171aa    MW: 19476.9 Da    PI: 8.6631
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.158540.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260134.54.1e-4210108199
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     aCaaCk++rr+C+kdC+lapyfpa+qpk f+n+h+lFG+ n++k+lk++++++++++m+s++ye+++r r Pv+G++gvi++l+ q++q+++el 
  Cucsa.158540.1  10 ACAACKYQRRRCSKDCALAPYFPADQPKMFQNAHRLFGVCNIMKILKQVHPSQKDETMTSIIYESNMRSRFPVHGCCGVIWQLHYQIQQVAEELR 104
                     7*********************************************************************************************9 PP

          DUF260  96 llke 99 
                     l+++
  Cucsa.158540.1 105 LVRS 108
                     9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.5869110IPR004883Lateral organ boundaries, LOB
PfamPF031958.3E-4010107IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009556Biological Processmicrosporogenesis
GO:0009786Biological Processregulation of asymmetric cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 171 aa     Download sequence    Send to blast
MTIKGGTSQA CAACKYQRRR CSKDCALAPY FPADQPKMFQ NAHRLFGVCN IMKILKQVHP  60
SQKDETMTSI IYESNMRSRF PVHGCCGVIW QLHYQIQQVA EELRLVRSRV DMVKEQFNQM  120
NNIGISETAG VVGNNDVAYP IYTQQPQQQQ YNSQQQQYNS ASLVNQGTDA X
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-2761037104LOB family transfactor Ramosa2.1
5ly0_B3e-2761037104LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818891e-167LN681889.1 Cucumis melo genomic scaffold, anchoredscaffold00051.
GenBankLN7132631e-167LN713263.1 Cucumis melo genomic chromosome, chr_9.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022993658.11e-88LOB domain-containing protein 27-like
SwissprotQ9STS62e-45LBD27_ARATH; LOB domain-containing protein 27
TrEMBLA0A0A0KXA11e-124A0A0A0KXA1_CUCSA; Uncharacterized protein
STRINGXP_004148705.11e-125(Cucumis sativus)
STRINGXP_004172833.11e-125(Cucumis sativus)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44152958
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.12e-47LOB domain-containing protein 27
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]
  4. Kim MJ,Kim M,Kim J
    Combinatorial interactions between LBD10 and LBD27 are essential for male gametophyte development in Arabidopsis.
    Plant Signal Behav, 2015. 10(8): p. e1044193
    [PMID:26252070]
  5. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]