PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.158420.1
Common NameCsa_5G635430, LOC101212093
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family HD-ZIP
Protein Properties Length: 306aa    MW: 33992 Da    PI: 6.7023
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.158420.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.74e-1884136456
                     -SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox   4 RttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                     + +++ eq+++Le+ Fe  +++  e++ +LAk lgL+ rq+ +WFqNrRa++k
  Cucsa.158420.1  84 KKRLNLEQVKALEKSFEVGNKLEPERKMQLAKALGLQPRQIAIWFQNRRARWK 136
                     4568889*********************************************9 PP

2HD-ZIP_I/II127.65.5e-4182172191
     HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreel 91 
                     ekk+rl+ eqvk+LE+sFe  +kLeperK++la++Lglqprq+a+WFqnrRAR+ktkqlE+dye+Lk++++alk++n+ L++++++L++el
  Cucsa.158420.1  82 EKKKRLNLEQVKALEKSFEVGNKLEPERKMQLAKALGLQPRQIAIWFQNRRARWKTKQLERDYEVLKKQFEALKADNDVLQAQNTKLHAEL 172
                     69**************************************************************************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.5E-1961139IPR009057Homeodomain-like
SuperFamilySSF466894.71E-1981140IPR009057Homeodomain-like
SMARTSM003892.1E-1781142IPR001356Homeobox domain
PROSITE profilePS5007116.53682138IPR001356Homeobox domain
CDDcd000867.08E-1783139No hitNo description
PfamPF000462.4E-1584136IPR001356Homeobox domain
PRINTSPR000311.1E-5109118IPR000047Helix-turn-helix motif
PROSITE patternPS000270113136IPR017970Homeobox, conserved site
PRINTSPR000311.1E-5118134IPR000047Helix-turn-helix motif
PfamPF021832.7E-14138178IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 306 aa     Download sequence    Send to blast
MASPHHHSHS FMFQSRPAPD HHEYIPSASF NTIPSCPPHL YFHDGVVPVM MKRSMSFSEV  60
ENGCEDVNGD EGLSDDGLAL GEKKKRLNLE QVKALEKSFE VGNKLEPERK MQLAKALGLQ  120
PRQIAIWFQN RRARWKTKQL ERDYEVLKKQ FEALKADNDV LQAQNTKLHA ELLALKTKDS  180
GETAGGGGAT MNLKKENERC WSSDNSCDIN LDISNTQTPI GGSGGRGCSQ PGMIKDLFPS  240
AAFRSAAITQ LLQHGSSRST VDQHPQVIQE ESFSQMFNGI EEQQQTAAAA GFWPWSTSDQ  300
NSHFH*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1130138RRARWKTKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818890.0LN681889.1 Cucumis melo genomic scaffold, anchoredscaffold00051.
GenBankLN7132630.0LN713263.1 Cucumis melo genomic chromosome, chr_9.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004148689.10.0PREDICTED: homeobox-leucine zipper protein ATHB-20
SwissprotQ004662e-78HAT7_ARATH; Homeobox-leucine zipper protein HAT7
TrEMBLA0A0A0KS900.0A0A0A0KS90_CUCSA; Uncharacterized protein
STRINGXP_008459304.10.0(Cucumis melo)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF127133106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G15150.11e-80homeobox 3
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]