PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.141640.1
Common NameCsa_1G595880, LOC101207344
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family GRF
Protein Properties Length: 334aa    MW: 37815.4 Da    PI: 9.7874
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.141640.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC77.71.1e-2476119144
             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                     d+epgrCrRtDGKkWRCs+++++++k+CErH+hrg++rsrk+++
  Cucsa.141640.1  76 DPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNRSRKPVD 119
                     79***************************************986 PP

2QLQ59.31.1e-20843237
             QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                    +FT aQ+q+L++Q+l++Ky++++ P+PpeLl+ i++
  Cucsa.141640.1  8 PFTSAQWQELEHQALIFKYMVSGIPIPPELLFSIKR 43
                    8*******************************9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009517.6E-13743IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.3E-15841IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.862843IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.76576120IPR014977WRC domain
PfamPF088791.8E-2077118IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MSARSMFPFT SAQWQELEHQ ALIFKYMVSG IPIPPELLFS IKRSALDSPF TSKLFPHHPQ  60
PVGWNYLQMS LGRKIDPEPG RCRRTDGKKW RCSKEAYPDS KYCERHMHRG KNRSRKPVDV  120
LKTTATNDIN HLSNPTFSSL NSNSSLLSYR PFPAHQISST PNNGNGISMK DTNTLLLLEP  180
GSYSDKNPDY RSRYTCGLKE EVNEKVFFSQ EPSEAIGRAD FSASSIASSL QLTPLTMSSS  240
LYPKQNNSSS LQSDQSSFYQ LHQNLTEPLK QQKRDESQKT VHRFFDEWPP KDRGSWLDFA  300
DKSSNTSSVS TTRLSISIPT ASNDFPIFRS KNP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN7132560.0LN713256.1 Cucumis melo genomic chromosome, chr_2.
GenBankLN6818060.0LN681806.1 Cucumis melo genomic scaffold, anchoredscaffold00025.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004144026.10.0PREDICTED: growth-regulating factor 4-like
TrEMBLA0A0A0LZJ10.0A0A0A0LZJ1_CUCSA; Uncharacterized protein
STRINGGLYMA09G07990.11e-110(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40433459
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.11e-56growth-regulating factor 5
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]