PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.139480.1
Common NameCsa_6G181550, LOC101207667
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family LBD
Protein Properties Length: 163aa    MW: 18105.8 Da    PI: 5.5815
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.139480.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260130.95.3e-4171061100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +Ca+Ck+lrr+CakdC++apyfp ++p kfa+vhk+FGasnv+k+l+++p ++r da+ss+vyeA ar++dPvyG+vg il lq++++ql+ +l 
  Cucsa.139480.1   7 PCASCKLLRRRCAKDCIFAPYFPPHDPLKFAIVHKIFGASNVSKMLQEVPVDQRADAVSSMVYEASARMQDPVYGCVGKILFLQNEVSQLEIQLG 101
                     7*******************************************************************************************999 PP

          DUF260  96 llkee 100
                     ++++e
  Cucsa.139480.1 102 AARAE 106
                     88876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.4256107IPR004883Lateral organ boundaries, LOB
PfamPF031952.1E-407103IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 163 aa     Download sequence    Send to blast
MGVGSSPCAS CKLLRRRCAK DCIFAPYFPP HDPLKFAIVH KIFGASNVSK MLQEVPVDQR  60
ADAVSSMVYE ASARMQDPVY GCVGKILFLQ NEVSQLEIQL GAARAEILML QMRQQQEASI  120
TFPMTTTQMD QDEQNLMILS NADSSNSFHV FQAADDHYPL WT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN7132651e-106LN713265.1 Cucumis melo genomic chromosome, chr_11.
GenBankLN6819221e-106LN681922.1 Cucumis melo genomic scaffold, anchoredscaffold00082.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004143222.11e-120PREDICTED: LOB domain-containing protein 12
SwissprotQ8LBW32e-65LBD12_ARATH; LOB domain-containing protein 12
TrEMBLA0A0A0KBK51e-120A0A0A0KBK5_CUCSA; Uncharacterized protein
STRINGVIT_06s0004g07200.t011e-66(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16643497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G30130.11e-66LBD family protein
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]