PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.124600.1
Common NameCsa_6G446400
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family TCP
Protein Properties Length: 208aa    MW: 22215 Da    PI: 8.3552
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.124600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP109.45.2e-3454134686
             TCP   6 drhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnss 86 
                     ++++++h kv+gR+RRvR++a+caar+F+L++eLG+ + ++tieWLl+qa+p+i+++tgt++ ++   +++ss  ++s  s
  Cucsa.124600.1  54 SSSKDRHIKVNGRGRRVRMPALCAARIFQLTRELGHRSEGETIEWLLRQAEPSIIAATGTGTVPSGPISTVSSAMASSGRS 134
                     689*********************************************************888884444444443333332 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036345.5E-3055172IPR005333Transcription factor, TCP
PROSITE profilePS5136926.53756110IPR017887Transcription factor TCP subgroup
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
Sequence ? help Back to Top
Protein Sequence    Length: 208 aa     Download sequence    Send to blast
MGSDIVLHKF PSSSDPHSQP PTASHSVVGS NSSPVTITRQ SLLPRKSNTP LSSSSSKDRH  60
IKVNGRGRRV RMPALCAARI FQLTRELGHR SEGETIEWLL RQAEPSIIAA TGTGTVPSGP  120
ISTVSSAMAS SGRSVSCRVQ PVSVGGSGQG MFAMPPPSCR LDLCQPVGME YSAAGNDYRH  180
MPFTALLLQP STAEETEERQ EEEVFRE*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818760.0LN681876.1 Cucumis melo genomic scaffold, anchoredscaffold00068.
GenBankLN7132620.0LN713262.1 Cucumis melo genomic chromosome, chr_8.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004143267.11e-149PREDICTED: transcription factor TCP11-like
SwissprotQ9SJK72e-44TCP11_ARATH; Transcription factor TCP11
TrEMBLA0A0A0KH861e-146A0A0A0KH86_CUCSA; Uncharacterized protein
STRINGXP_004156285.11e-147(Cucumis sativus)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38193363
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37000.18e-43TCP family protein
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]