PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.117300.2
Common NameCsa_2G000170, LOC101214722
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family GRF
Protein Properties Length: 319aa    MW: 36656.6 Da    PI: 8.854
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.117300.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC78.66.1e-2579123145
             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                     d+epgrCrRtDGKkWRCs+++++++k+CErH+hrg++rsrk++e+
  Cucsa.117300.2  79 DPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGKNRSRKPVEQ 123
                     79****************************************985 PP

2QLQ60.83.7e-21842236
             QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36
                    +FTaaQ+q+L++Q+l++Ky+++++P+PpeLl  i+
  Cucsa.117300.2  8 PFTAAQWQELEHQALIFKYMVSGVPIPPELLYSIK 42
                    8*****************************98886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009514.6E-13743IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088802.6E-16841IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166623.009843IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.91879123IPR014977WRC domain
PfamPF088791.0E-2080122IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MSARNRFPFT AAQWQELEHQ ALIFKYMVSG VPIPPELLYS IKATSLDTPF ISRLFPHQYP  60
QVSAVGWNYL QMGSGRKIDP EPGRCRRTDG KKWRCSKEAY PDSKYCERHM HRGKNRSRKP  120
VEQVLKTTPL NSSNPSTPAI SSITHNSETH PHPHPHPFHY QNPSASSHPS LLPDYRNRYI  180
YGEKEENSFV REQHSGNMRG FSGSSMDDSW QLTPLTMSCS SSSSRYKNCS ALQGDYSSYL  240
QLQSFEKYNE MQSKMDRDQE PQKTVHHFFD EWSPKHRESW DDLDDKSSNT GSVSATRLSM  300
STPNTDSSIF SFNKRNEN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN7132590.0LN713259.1 Cucumis melo genomic chromosome, chr_5.
GenBankLN6818470.0LN681847.1 Cucumis melo genomic scaffold, anchoredscaffold00003.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004141176.10.0PREDICTED: growth-regulating factor 5 isoform X1
TrEMBLA0A0A0LFP90.0A0A0A0LFP9_CUCSA; Uncharacterized protein
STRINGVIT_11s0016g01250.t011e-104(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.11e-57growth-regulating factor 5
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]