PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.113510.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family bZIP
Protein Properties Length: 198aa    MW: 22655.4 Da    PI: 8.0318
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.113510.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_143.19.2e-1493149561
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklks 61 
                     ++ rr+++NRe+ArrsR RKk++ieeL+  v +Le  N++L ++l +  +  ++   
  Cucsa.113510.1  93 RKLRRMISNRESARRSRMRKKKQIEELQYQVGQLEVSNRQLSEKLIQVVECNQQILH 149
                     5789***************************************99887777666655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003385.2E-1289153IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.42791137IPR004827Basic-leucine zipper domain
PfamPF001701.9E-1293151IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.3E-1193147No hitNo description
SuperFamilySSF579591.63E-1193147No hitNo description
CDDcd147027.96E-1494142No hitNo description
PROSITE patternPS00036096111IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 198 aa     Download sequence    Send to blast
MMETNRTMMR RSEGDNNDHE DHESNGSCGN LIHREIVFPS TMITTSHTPT NNNNSNVFSS  60
PNSASCYSND NVLDVVEVLD VHRHHHLTVM AERKLRRMIS NRESARRSRM RKKKQIEELQ  120
YQVGQLEVSN RQLSEKLIQV VECNQQILHE NAELKRKVSS LQIILTDFLT PLRNCEDAFG  180
NSIIKNNRRA AAEPNSS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819321e-160LN681932.1 Cucumis melo genomic scaffold, anchoredscaffold00001.
GenBankLN7132661e-160LN713266.1 Cucumis melo genomic chromosome, chr_12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004137610.11e-143PREDICTED: basic leucine zipper 43-like
TrEMBLA0A1S3C0641e-104A0A1S3C064_CUCME; light-inducible protein CPRF3-like
STRINGXP_004137610.11e-142(Cucumis sativus)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130442430
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60830.11e-31basic leucine-zipper 70