PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.113410.1
Common NameCsa_1G039890, LOC101206747
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family SBP
Protein Properties Length: 549aa    MW: 60369.3 Da    PI: 8.0517
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.113410.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP133.47.3e-42177253278
                     -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
             SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                     Cqv gC++dls+ k+yh+rhkvCevhsk+++v+v+g+eqrfCqqCsrfh l efD++krsCr+rLa+hnerrrk+q 
  Cucsa.113410.1 177 CQVYGCNKDLSSSKDYHKRHKVCEVHSKTAKVIVNGIEQRFCQQCSRFHLLVEFDDGKRSCRKRLAGHNERRRKPQV 253
                     **************************************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.7E-32173238IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.359174251IPR004333Transcription factor, SBP-box
SuperFamilySSF1036125.1E-39175255IPR004333Transcription factor, SBP-box
PfamPF031101.4E-31177250IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 549 aa     Download sequence    Send to blast
MESWNYGSQG KGFLSDEMNS STNSPLRSKY SLLGWEFKNP CSFGDNMLLT SGAQHVENQS  60
FGELEFPQMV GKQLPDDSVS GVLNTKTDGG RNLNLVLPTS HPLHGEEEST SKLSGSIVDS  120
NNRDSSLIDL KLGRFIDQGD AHSSKYSKRA AISSSTESST SQKKMRSQGV NFQTAFCQVY  180
GCNKDLSSSK DYHKRHKVCE VHSKTAKVIV NGIEQRFCQQ CSRFHLLVEF DDGKRSCRKR  240
LAGHNERRRK PQVSFHSGRA QRLLQPYNGI GDSRFQEKTL TATSFICKDI LSSGLYYPEK  300
LGENDWCKRV KVEGKSDYNS ISATSLSNRH LNVKSPLLPY DFEVQIPPFQ ENGTSTAPTV  360
NMLSETTCQY SHNVGGPHID THPLFHQTTL SSEDFGVYDA ASTIQGLSGI PDSGCALSLL  420
SSQSQSASNH PSIVHIPRAF IMSESQSNYS MSELSEKLMG VSPQASSTGI TSKFASGMSE  480
AQMGSIPTCG SSDRTVTFQI PGRVLHRSGL ANPKANISYE RTPTIDLLQL SSQLQRVEHQ  540
RHSMQDSA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-291762501084squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819320.0LN681932.1 Cucumis melo genomic scaffold, anchoredscaffold00001.
GenBankLN7132660.0LN713266.1 Cucumis melo genomic chromosome, chr_12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004137448.10.0PREDICTED: squamosa promoter-binding-like protein 6 isoform X1
TrEMBLA0A0A0LQA60.0A0A0A0LQA6_CUCSA; Uncharacterized protein
STRINGXP_004137448.10.0(Cucumis sativus)
STRINGXP_004157437.10.0(Cucumis sativus)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF18193493
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.13e-50SBP family protein
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]