PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.113300.1
Common NameCsa_1G039270, LOC101204687
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family TCP
Protein Properties Length: 125aa    MW: 14311.6 Da    PI: 10.5813
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.113300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP874.4e-2728109388
             TCP   3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssg 88 
                     g+kdrhsk++T +g+RdRR+Rls+++a++++dLq++LG+ ++sk i+WL+     +i++l+ +++++  +     + s  ++s +g
  Cucsa.113300.1  28 GGKDRHSKVCTIKGLRDRRIRLSIPTAIQLYDLQNKLGLSQPSKVIDWLIDVTRFEIDKLPPLPFPKDFDP----NASILHHSDIG 109
                     68*************************************************************77666333....11122222333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036341.0E-242999IPR005333Transcription factor, TCP
PROSITE profilePS5136925.9482987IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 125 aa     Download sequence    Send to blast
MKKARTCSRQ GQFLRGNPRI FRVSPFFGGK DRHSKVCTIK GLRDRRIRLS IPTAIQLYDL  60
QNKLGLSQPS KVIDWLIDVT RFEIDKLPPL PFPKDFDPNA SILHHSDIGD AAFKAKNEET  120
DHTLL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zkt_A9e-193488155Putative transcription factor PCF6
5zkt_B9e-193488155Putative transcription factor PCF6
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a pivotal role in the control of morphogenesis of shoot organs by negatively regulating the expression of boundary-specific genes such as CUC genes, probably through the induction of miRNA (e.g. miR164). Participates in ovule develpment (PubMed:25378179). {ECO:0000269|PubMed:17307931, ECO:0000269|PubMed:25378179}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6819321e-179LN681932.1 Cucumis melo genomic scaffold, anchoredscaffold00001.
GenBankLN7132661e-179LN713266.1 Cucumis melo genomic chromosome, chr_12.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011660343.11e-87PREDICTED: transcription factor TCP5
SwissprotQ9FME31e-38TCP5_ARATH; Transcription factor TCP5
TrEMBLA0A0A0LTI32e-86A0A0A0LTI3_CUCSA; Uncharacterized protein
STRINGXP_004137441.14e-87(Cucumis sativus)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF93234119
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60970.18e-34TEOSINTE BRANCHED 1, cycloidea and PCF transcription factor 5
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]
  4. Koyama T,Sato F,Ohme-Takagi M
    Roles of miR319 and TCP Transcription Factors in Leaf Development.
    Plant Physiol., 2017. 175(2): p. 874-885
    [PMID:28842549]