![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
Previous version:
v3.0
v4.0
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Cucsa.113300.1 | ||||||||
Common Name | Csa_1G039270, LOC101204687 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
Family | TCP | ||||||||
Protein Properties | Length: 125aa MW: 14311.6 Da PI: 10.5813 | ||||||||
Description | TCP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | TCP | 87 | 4.4e-27 | 28 | 109 | 3 | 88 |
TCP 3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssaseceaesssssasnsssg 88 g+kdrhsk++T +g+RdRR+Rls+++a++++dLq++LG+ ++sk i+WL+ +i++l+ +++++ + + s ++s +g Cucsa.113300.1 28 GGKDRHSKVCTIKGLRDRRIRLSIPTAIQLYDLQNKLGLSQPSKVIDWLIDVTRFEIDKLPPLPFPKDFDP----NASILHHSDIG 109 68*************************************************************77666333....11122222333 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF03634 | 1.0E-24 | 29 | 99 | IPR005333 | Transcription factor, TCP |
PROSITE profile | PS51369 | 25.948 | 29 | 87 | IPR017887 | Transcription factor TCP subgroup |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 125 aa Download sequence Send to blast |
MKKARTCSRQ GQFLRGNPRI FRVSPFFGGK DRHSKVCTIK GLRDRRIRLS IPTAIQLYDL 60 QNKLGLSQPS KVIDWLIDVT RFEIDKLPPL PFPKDFDPNA SILHHSDIGD AAFKAKNEET 120 DHTLL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5zkt_A | 9e-19 | 34 | 88 | 1 | 55 | Putative transcription factor PCF6 |
5zkt_B | 9e-19 | 34 | 88 | 1 | 55 | Putative transcription factor PCF6 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Plays a pivotal role in the control of morphogenesis of shoot organs by negatively regulating the expression of boundary-specific genes such as CUC genes, probably through the induction of miRNA (e.g. miR164). Participates in ovule develpment (PubMed:25378179). {ECO:0000269|PubMed:17307931, ECO:0000269|PubMed:25378179}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LN681932 | 1e-179 | LN681932.1 Cucumis melo genomic scaffold, anchoredscaffold00001. | |||
GenBank | LN713266 | 1e-179 | LN713266.1 Cucumis melo genomic chromosome, chr_12. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011660343.1 | 1e-87 | PREDICTED: transcription factor TCP5 | ||||
Swissprot | Q9FME3 | 1e-38 | TCP5_ARATH; Transcription factor TCP5 | ||||
TrEMBL | A0A0A0LTI3 | 2e-86 | A0A0A0LTI3_CUCSA; Uncharacterized protein | ||||
STRING | XP_004137441.1 | 4e-87 | (Cucumis sativus) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF932 | 34 | 119 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G60970.1 | 8e-34 | TEOSINTE BRANCHED 1, cycloidea and PCF transcription factor 5 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Cucsa.113300.1 |
Entrez Gene | 101204687 |
Publications ? help Back to Top | |||
---|---|---|---|
|