PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.109180.1
Common NameCsa_2G251490, LOC101205298
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family GATA
Protein Properties Length: 335aa    MW: 36470.6 Da    PI: 6.0676
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.109180.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA55.95.9e-18253286134
            GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                     Cs+C + kTp+WR gp+g ktLCnaCG++y++ +
  Cucsa.109180.1 253 CSHCLVQKTPQWRTGPNGAKTLCNACGVRYKSGR 286
                     *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169921.4E-698330IPR016679Transcription factor, GATA, plant
SMARTSM004015.8E-16247297IPR000679Zinc finger, GATA-type
SuperFamilySSF577165.7E-14248310No hitNo description
Gene3DG3DSA:3.30.50.102.3E-14251284IPR013088Zinc finger, NHR/GATA-type
PROSITE profilePS5011411.451251283IPR000679Zinc finger, GATA-type
CDDcd002021.15E-13252309No hitNo description
PfamPF003206.3E-16253286IPR000679Zinc finger, GATA-type
PROSITE patternPS003440253278IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MEFLEAKALK SSFHWELAMK SAQQDALVEE VWCLNGPNLV SGEDFEIEEF LNFPNGDLEH  60
GSSLRLQEDD DCEEFEKNRF SVSSNSNQSD GSPVVGEEDS KSLLAVELAF PGDSLTDLEW  120
VSQFVDDSSS EFSCAAVAFN RSEPEKKLTG TVISCLPTFF PVRPRTKRSR QSRQAKSAGS  180
SLNQSPSSSS SSTSSGVSSA APRFIFSDAG ENVDFLNVTG EPPKKQRKKP SSPSPSSTGL  240
LPTGSTGQIP RRCSHCLVQK TPQWRTGPNG AKTLCNACGV RYKSGRLFPE YRPALSPTFC  300
SGVHSNSHRK VLEMRKTKEV PQPATELAPM VPSY*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1222229PKKQRKKP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN7132650.0LN713265.1 Cucumis melo genomic chromosome, chr_11.
GenBankLN6819120.0LN681912.1 Cucumis melo genomic scaffold, anchoredscaffold00059.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004150140.10.0PREDICTED: GATA transcription factor 5-like
RefseqXP_011649263.10.0PREDICTED: GATA transcription factor 5-like
TrEMBLA0A0A0LLB30.0A0A0A0LLB3_CUCSA; Uncharacterized protein
STRINGPOPTR_0009s12620.12e-77(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.22e-44GATA transcription factor 5
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]