PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.108670.1
Common NameCsa_3G194380, LOC101204946
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family G2-like
Protein Properties Length: 448aa    MW: 48859.9 Da    PI: 7.947
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.108670.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1031.8e-32259312255
         G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                     pr+rWt+ LH+rFv+ave+LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Cucsa.108670.1 259 PRMRWTTSLHARFVHAVEHLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 312
                     9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.15E-15256312IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.2E-29257312IPR009057Homeodomain-like
TIGRFAMsTIGR015578.5E-24259312IPR006447Myb domain, plants
PfamPF002493.0E-7260311IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009887Biological Processorgan morphogenesis
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009956Biological Processradial pattern formation
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010158Biological Processabaxial cell fate specification
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 448 aa     Download sequence    Send to blast
MPLEGIFIEP SSTSLPDLSL QISPPNVSSS SSSSSSSSSS SYSSIRTLSH GFSETSFDLL  60
IQRNSQFQNN FSNDSRTQTE LSLGTNNNNN NSLFGGATLH PPPTLPHLRG LSMFDVSSDG  120
LRPIKGIPVY HNRPFPFLGV DQKDHHYFHQ FPSACFFPNY SNTNGNNGGG GVNQMGYHHR  180
GGGGVGGNNN NCSARFNNGV VCVEAINKCL NNNSNSNSNN AASCCCSSSS SDVCSSHGMM  240
MMRSRFLQKL PPKRSMRAPR MRWTTSLHAR FVHAVEHLGG HERATPKSVL ELMDVKDLTL  300
AHVKSHLQMY RTVKTTDKPA ASSGQSDGSG EDDVSPTIMG TTRGDHGGSK QFSDQRAPPD  360
RSGQSPPDVE FGCSTLWSNS SRDVWPQTNS NEMDNNVNTP TLSTQQKTMH QIQECDSGAM  420
KRYNSECKKP SLEFRLGRAE WDVKQDH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A7e-18260314458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B7e-18260314458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A7e-18260314357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B7e-18260314357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C7e-18260314357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D7e-18260314357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A7e-18260314458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C7e-18260314458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D7e-18260314458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F7e-18260314458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H7e-18260314458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J7e-18260314458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818510.0LN681851.1 Cucumis melo genomic scaffold, anchoredscaffold00038.
GenBankLN7132600.0LN713260.1 Cucumis melo genomic chromosome, chr_6.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004140729.10.0PREDICTED: transcription repressor KAN1-like isoform X1
TrEMBLA0A0A0LBR30.0A0A0A0LBR3_CUCSA; Uncharacterized protein
STRINGXP_004140729.10.0(Cucumis sativus)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17563391
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.11e-56G2-like family protein
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]