PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.108150.1
Common NameCsa_3G183960, LOC101212382
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB_related
Protein Properties Length: 276aa    MW: 30967.9 Da    PI: 8.7806
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.108150.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.81e-123074147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r +WT+ E++++++a++++  + Wk+I + +g  +t  q++s+ qky
   Cucsa.108150.1 30 RESWTEPEHDKFLEAIQLFDRD-WKKIEAFVG-SKTVIQIRSHAQKY 74
                     789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466896.28E-162480IPR009057Homeodomain-like
PROSITE profilePS5129413.2872579IPR017930Myb domain
TIGRFAMsTIGR015572.5E-182877IPR006447Myb domain, plants
SMARTSM007175.8E-102977IPR001005SANT/Myb domain
PfamPF002492.1E-103074IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-63070IPR009057Homeodomain-like
CDDcd001674.52E-83275No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 276 aa     Download sequence    Send to blast
MALPFETVIT SSRDDLSKRA RKPYTITKCR ESWTEPEHDK FLEAIQLFDR DWKKIEAFVG  60
SKTVIQIRSH AQKYFLKVEK SGTGEHLPPP RPKRKAAHPY PQKSSKNGVA LVTEPFQSSS  120
VEPKYNIKPD SSSTPASFIS ATAMSSRADN SIQTVNFSQG AGGLNCEITK QVIENNCSSS  180
TDHTTRARFP TKSSIEEHNS LQLRVLPDFG QVYNFIGSVF DPKASNHLKR LEQMDQIDVE  240
TVLLLMRNLA INLTSSDFED HKRVLSSYDG FMEHG*
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818482e-87LN681848.1 Cucumis melo genomic scaffold, anchoredscaffold00006.
GenBankLN7132602e-87LN713260.1 Cucumis melo genomic chromosome, chr_6.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011651185.10.0PREDICTED: protein REVEILLE 6 isoform X1
SwissprotQ8H0W31e-104RVE6_ARATH; Protein REVEILLE 6
TrEMBLA0A1S3AYG10.0A0A1S3AYG1_CUCME; protein REVEILLE 6-like isoform X2
STRINGXP_004157187.10.0(Cucumis sativus)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF11193396
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G52660.12e-93MYB_related family protein
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]
  4. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  5. Gray JA,Shalit-Kaneh A,Chu DN,Hsu PY,Harmer SL
    The REVEILLE Clock Genes Inhibit Growth of Juvenile and Adult Plants by Control of Cell Size.
    Plant Physiol., 2017. 173(4): p. 2308-2322
    [PMID:28254761]