PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.103390.2
Common NameCsa_6G496380, LOC101216004
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family GRF
Protein Properties Length: 563aa    MW: 60907.6 Da    PI: 7.37
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.103390.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC76.72.3e-24224268145
             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                     d+epgrCrRtDGKkWRCsr++++++k+CErH++rgr+rsrk++e 
  Cucsa.103390.2 224 DPEPGRCRRTDGKKWRCSRDAVADQKYCERHINRGRHRSRKPVEG 268
                     79****************************************985 PP

2QLQ575.9e-20155191137
             QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                     ++FT +Q+ +L++Q+l+yKyL++n+PvP++Ll +++k
  Cucsa.103390.2 155 GPFTQSQWIELEHQALIYKYLSSNVPVPSNLLIPLKK 191
                     59*******************************9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.3E-11155191IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.559156191IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088802.4E-14156189IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.287224268IPR014977WRC domain
PfamPF088797.1E-21225267IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009624Biological Processresponse to nematode
GO:0048364Biological Processroot development
GO:0048366Biological Processleaf development
GO:0061062Biological Processregulation of nematode larval development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 563 aa     Download sequence    Send to blast
MDFGVVGLDS FVDSSDAPSP HPASDPDTNL KSLGSAFSKQ DRSGFVDDDW RSSKIPKTET  60
VSASSKTMPL HQGFPLLRSN TLLSSDGRQK EHMLSFSSVK SETSLQSKDS DLISRNTQNS  120
IFPYNQQKSS VYSRNTGCVS GSYSSMHGPV AGIRGPFTQS QWIELEHQAL IYKYLSSNVP  180
VPSNLLIPLK KSLYPYGLTC SSAGSLPPNT RWGSFHLGFS GNADPEPGRC RRTDGKKWRC  240
SRDAVADQKY CERHINRGRH RSRKPVEGQT GHSAPGTTNP TAMVATMSTS LSSTVMPSGG  300
ASNNLPIIQH QLKSLHPVAA SDPGADAPVN RIQESGGLSM MSSTVNLMSS NDKSGAKQEI  360
SIGESTQSEF GLVSTDSLLN PSQRGSYPNP KNYDSFLIFN DQESQDQDQH PLRQFFEDWP  420
KDQSSRSVMT WPEEFKSDWT QLSMSIPMSD FSSSSSSPTH EKLAQSPLRL SRELEPIQMN  480
LGVSRNDGEL VQKQGNQITM SWGSSMGGPL GEALTNGSSC VKASKVPPSL NLLAEGWDGG  540
QLGSSPTGVL QKATFCSLSN SS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN7132620.0LN713262.1 Cucumis melo genomic chromosome, chr_8.
GenBankLN6818750.0LN681875.1 Cucumis melo genomic scaffold, anchoredscaffold00007.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004143409.10.0PREDICTED: growth-regulating factor 1
TrEMBLA0A0A0KG060.0A0A0A0KG06_CUCSA; Uncharacterized protein
STRINGVIT_00s0494g00010.t010.0(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22840.11e-111growth-regulating factor 1
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]