PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.103040.1
Common NameCsa_6G495010, LOC101213756
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family GRAS
Protein Properties Length: 474aa    MW: 52902.7 Da    PI: 6.5594
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.103040.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS303.45.3e-93714702373
            GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvs.elykal.ppsetseknsseelaalklfsevsPilkfs 94 
                     ++lL++cA+a++s+d++laq++L+ l+++a pdgd++qRl++ f++AL +r +++++ ++ +a+ ++ ++s ++++ +l+ l +f++++P+++f+
  Cucsa.103040.1  71 EQLLVHCANAIESNDATLAQQILWVLNNIAPPDGDSNQRLTSAFLRALITRATNTGNcKILAAItTAFSSSITTHTFSLMDLAAFVDLTPWHRFG 165
                     79***************************************************9332133333313334444446666666667*********** PP

            GRAS  95 hltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg.....skeeleetgerLakfAeelgvpfefnvl... 181
                     + +aN aIl+a+eg ++vH++D+++++++Q p+L++a+a+R e pp l++T+v+  + +      + ++ e+g +L +fA++ +v++ef+v+   
  Cucsa.103040.1 166 FTAANVAILDAIEGYSAVHVVDLSLMHCMQIPTLIDAIATRFEVPPLLKLTTVAVVAVKeaspmLELSYDELGAKLVNFARSKNVTMEFRVVpsc 260
                     ***************************************************9988665566766788889*********************9887 PP

            GRAS 182 vakrledleleeLrvkp.......gEalaVnlvlqlhrll..............desvsleserdevLklvkslsPkvvvvveqeadhnsesFle 255
                     +++ ++ l +e++rv++       +Eal+ n++++lh+++              d s s++s r+ +Lk+v+sl P++vv+v+++ad +s+++++
  Cucsa.103040.1 261 HTDGFARL-IEQIRVQHliygpenNEALVFNCHMMLHYIPeetlnpnpnpspnfDISSSSSSIRSMFLKAVRSLDPTIVVLVDEDADFTSTKLVT 354
                     44444444.555555555555588****************************9977777777789****************************** PP

            GRAS 256 rflealeyysalfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyr 350
                     r+ +a++y +  +ds+++ lpr s++r ++E+  + ++i+nv+a+eg +r++r e +++W +r+ +a F+ vp+ e+a++++k++l +++  g+ 
  Cucsa.103040.1 355 RLRSAFNYLWIPYDSMDSFLPRSSKQREWYEAD-ICWKIENVIAHEGVQRVQRLEPKGRWVQRMVNAKFRGVPFVEEAVSEVKTMLDEHA-AGWG 447
                     *********************************.********************************************************.999* PP

            GRAS 351 veeesgslvlgWkdrpLvsvSaW 373
                     +++e++ l+l+Wk++ +v+++aW
  Cucsa.103040.1 448 LKKEEDHLLLTWKGHDVVFATAW 470
                     *********************** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098542.38944452IPR005202Transcription factor GRAS
PfamPF035141.8E-9071470IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 474 aa     Download sequence    Send to blast
MMQFSHTPQR FHPTTTATTP IPSSFSDISM SNKNQITTTT GPFRNRRPWP GLFPCSSKAL  60
GTCLGDANCM EQLLVHCANA IESNDATLAQ QILWVLNNIA PPDGDSNQRL TSAFLRALIT  120
RATNTGNCKI LAAITTAFSS SITTHTFSLM DLAAFVDLTP WHRFGFTAAN VAILDAIEGY  180
SAVHVVDLSL MHCMQIPTLI DAIATRFEVP PLLKLTTVAV VAVKEASPML ELSYDELGAK  240
LVNFARSKNV TMEFRVVPSC HTDGFARLIE QIRVQHLIYG PENNEALVFN CHMMLHYIPE  300
ETLNPNPNPS PNFDISSSSS SIRSMFLKAV RSLDPTIVVL VDEDADFTST KLVTRLRSAF  360
NYLWIPYDSM DSFLPRSSKQ REWYEADICW KIENVIAHEG VQRVQRLEPK GRWVQRMVNA  420
KFRGVPFVEE AVSEVKTMLD EHAAGWGLKK EEDHLLLTWK GHDVVFATAW VPC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5b3g_B1e-496547282474Protein SHORT-ROOT
5b3h_B3e-506647229420Protein SHORT-ROOT
5b3h_E3e-506647229420Protein SHORT-ROOT
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in plant development. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818750.0LN681875.1 Cucumis melo genomic scaffold, anchoredscaffold00007.
GenBankLN7132620.0LN713262.1 Cucumis melo genomic chromosome, chr_8.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004141989.20.0PREDICTED: scarecrow-like protein 32
SwissprotQ9SN221e-174SCL32_ARATH; Scarecrow-like protein 32
TrEMBLA0A0A0KLH60.0A0A0A0KLH6_CUCSA; Uncharacterized protein
STRINGXP_004166166.10.0(Cucumis sativus)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77023347
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49950.11e-162GRAS family protein
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]