PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.067270.1
Common NameCsa_4G310210, LOC101218250
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family Trihelix
Protein Properties Length: 260aa    MW: 31364.8 Da    PI: 9.419
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.067270.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix72.95.4e-2329110286
        trihelix   2 WtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                     W+  e+++L+++r  +++++++ k++  lW +v++km+++gf+rs +qCk+kw+nl +ryk +++++ k    ++ ++p++d+l+
  Cucsa.067270.1  29 WSVLETKELLAIRAALDKNFSEMKQNRMLWISVAEKMKAKGFNRSDEQCKCKWKNLVTRYKGCETMDPKA--LKH-QFPFYDDLH 110
                     9999****************************************************************95..444.79****997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500907.3172885IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.602.1E-42884IPR009057Homeodomain-like
PfamPF138373.0E-1928111No hitNo description
CDDcd122032.83E-162992No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 260 aa     Download sequence    Send to blast
MEDFCDLRRA VFHRIGVNAE AAGDRFPPWS VLETKELLAI RAALDKNFSE MKQNRMLWIS  60
VAEKMKAKGF NRSDEQCKCK WKNLVTRYKG CETMDPKALK HQFPFYDDLH TIFTARMQKN  120
WWVEAENRSG GSKRKANEDP NGDRELENEE KTKTKNGTKK RKWKRDNPEE HERNLKEILK  180
DFVKREMEME REWREAFRVR EEERRLKEEE WRMKMEGIER EKMMMEILWR ENEDKRRERE  240
EARAQKTDAL ISALLTNLT*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN7132620.0LN713262.1 Cucumis melo genomic chromosome, chr_8.
GenBankLN6818840.0LN681884.1 Cucumis melo genomic scaffold, anchoredscaffold00086.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011653700.10.0PREDICTED: trihelix transcription factor GT-3b isoform X2
SwissprotO804507e-56TGT3B_ARATH; Trihelix transcription factor GT-3b
TrEMBLA0A0A0KZY40.0A0A0A0KZY4_CUCSA; Uncharacterized protein
STRINGPOPTR_0006s10240.13e-73(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF17813385
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G01380.13e-43Trihelix family protein
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]