PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.048040.1
Common NameCsa_6G525240, LOC101213331
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family LBD
Protein Properties Length: 149aa    MW: 16717.8 Da    PI: 7.2428
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.048040.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260131.34.2e-41151151101
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +Ca+Ck+lrrkC  dC++apyfpa+qp+kf++vh+++Gasnv+k+lka + +ere++++slv+eAear++dPv+G+v++i  lqq+l++l++ela
  Cucsa.048040.1  15 PCASCKFLRRKCDVDCIFAPYFPADQPQKFEVVHRIYGASNVSKILKASRYDEREETVKSLVFEAEARLEDPVHGCVAFIAGLQQRLQRLQTELA 109
                     7********************************************************************************************** PP

          DUF260  96 llkeel 101
                      ++++l
  Cucsa.048040.1 110 IVQQQL 115
                     ***986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.17114115IPR004883Lateral organ boundaries, LOB
PfamPF031956.7E-3915113IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 149 aa     Download sequence    Send to blast
MSSSNSQSQK IYGSPCASCK FLRRKCDVDC IFAPYFPADQ PQKFEVVHRI YGASNVSKIL  60
KASRYDEREE TVKSLVFEAE ARLEDPVHGC VAFIAGLQQR LQRLQTELAI VQQQLLSYMA  120
SQLPPNSSYM ASELPPNSSY MASELPPNX
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN7132621e-147LN713262.1 Cucumis melo genomic chromosome, chr_8.
GenBankLN6818751e-147LN681875.1 Cucumis melo genomic scaffold, anchoredscaffold00007.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004134907.21e-102PREDICTED: LOB domain-containing protein 4-like
SwissprotQ9FKZ31e-41LBD36_ARATH; LOB domain-containing protein 36
TrEMBLA0A0A0KIS21e-102A0A0A0KIS2_CUCSA; Uncharacterized protein
STRINGVIT_19s0027g01120.t012e-42(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF16643497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.15e-38ASYMMETRIC LEAVES 2-like 1
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]