PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.043350.1
Common NameCsa_6G504690, LOC105435937
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family GATA
Protein Properties Length: 245aa    MW: 27798.6 Da    PI: 7.1423
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.043350.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA59.54.4e-19167200134
            GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                     Cs+Cg+ kTp+WR gp g k+LCnaCG+++++ +
  Cucsa.043350.1 167 CSHCGVQKTPQWRAGPLGAKSLCNACGVRFKSGR 200
                     *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004012.1E-15161215IPR000679Zinc finger, GATA-type
PROSITE profilePS5011412.308161197IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.101.4E-14164198IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577164.56E-14164224No hitNo description
CDDcd002021.24E-13166215No hitNo description
PfamPF003204.7E-17167200IPR000679Zinc finger, GATA-type
PROSITE patternPS003440167192IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MDIESAFKST PKLLFDDFWS SNLQNASSPS SDHIFVDQFL NFSDEEQQED EEKNNHSSVS  60
PPLQLQQVHH DTDQNSNHSS TNSSEDDFWS ITSTDFEDLD WLSHLVADST QEEYSAPTPS  120
VFLTHKPRNP LPNFHSYLNT PFPSKPRTKR PKISARGSGR VQAGRRCSHC GVQKTPQWRA  180
GPLGAKSLCN ACGVRFKSGR LFPEYRPACS PTFSNELHSN HHRKVLEMRR KKERERPQSG  240
MDLV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN7132620.0LN713262.1 Cucumis melo genomic chromosome, chr_8.
GenBankLN6818750.0LN681875.1 Cucumis melo genomic scaffold, anchoredscaffold00007.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011658035.11e-161PREDICTED: GATA transcription factor 7-like
SwissprotO655151e-45GATA7_ARATH; GATA transcription factor 7
TrEMBLA0A0A0KJA51e-161A0A0A0KJA5_CUCSA; Uncharacterized protein
STRINGGLYMA02G05710.24e-53(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF110834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36240.11e-46GATA transcription factor 7
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]