PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Cucsa.025330.1
Common NameCsa_7G394710, LOC101205486
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family HB-other
Protein Properties Length: 1072aa    MW: 119221 Da    PI: 9.3113
Description HB-other family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Cucsa.025330.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox17.76.1e-0669125157
                     TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
        Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57 
                     +r+R  ++++ ++ ++++F  +  +s++e +e+++  g++ +qV+ +F  +R + +k
  Cucsa.025330.1  69 KRPRDLLNPKAVKYMQTVFSIKDALSKKESREISALFGVKVTQVREFFNSQRSRVRK 125
                     799***************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500719.42666126IPR001356Homeobox domain
SMARTSM003895.4E-468130IPR001356Homeobox domain
SuperFamilySSF466891.33E-568128IPR009057Homeodomain-like
CDDcd000860.001269125No hitNo description
Gene3DG3DSA:1.10.10.605.4E-569136IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1072 aa     Download sequence    Send to blast
MEVLKDDFSN LEIGSSFDSF QKFLDSQKDL FRSQVDQLQT IVVTQCKLTG VNPLSQEMAA  60
GALSITIGKR PRDLLNPKAV KYMQTVFSIK DALSKKESRE ISALFGVKVT QVREFFNSQR  120
SRVRKLVRVS RERSIQSNSC KQLEVGGIAT NNDPSIPIDA VPLNSDAVVP LNSDAPMPLN  180
SEAPVPLYFD TPVPLNTIEP SNVDNGPSCS TQDSELSGID GVDKHFVQTI FSMMQKEETF  240
SGQVKLMEWI LQIQNSSVLC WFLTKGGAII LATWLSQAAA EEQTSLLYVI LEVFCHLPLH  300
KALPVHISAI LQSVNYLRFY RTSDISNRAR ILLSRWSKLL ARSQALKKPN GVKLLTNVQT  360
DMILKQSIGD IMSDESWRSN MDMPENFVTS NVNADNMRKP ESHQTLKLLP ASSDDLNRKN  420
VLGLSSSRFR ERRKVQMVEQ PDQKIAGRNS QAQRSSPASQ GRPMSTDDIQ KAKMRAQFMQ  480
NKYGKTGASN GRTVVKSVNV NKPLHIVSGA SSPASKVSLL PKFEDQKKAV ALFPKFNNKV  540
ETPLHSKIEM DFKDSLGEKC KRVQIQWRMP PEMKLNDLWR VGDGENSKEA GFQKNRNSRE  600
KETFYQTILD IPSNPKEPWD LEMDYDDSLT PEILTEQLPD NESSEAEVRN HVVDAAVPSE  660
VISSQDLKPN AAEPDLELLA VLLKNPELVY ALTSSQAGSL PTEETVQLLD MIKAAGGASN  720
LGGVTRMEKT VEKVEVSLPS PTPSSNAGTS GWKPAALRNP FSQRDSIAES RVALSSPPVD  780
TSSIAVSRIV TPNQQHTAMP PVSHQLPASV SQFSHSQTMI NGCQSHHVIH SHQHQQSIVN  840
SPNVQNPETA LPLRGFPINN QPLVNHLTPA ASSARIEGRS IVKPSFTSNI PERIPISFQS  900
PPSPTPTQMP PIQQQRQQPQ LQPFRSEHPH LHPHHQTRVN ISLPPAEKSA PSLGSWRPRQ  960
QDISSQYNNS GASANQNNDS KFVGGSMGVG RGGPSWGRSD FESWSPENSP VRNQEYNRPD  1020
KGFSEPRINS GRSYGPIDNN QQQQQRQRSP YGYGEQNRYG NNNRRWRDRE Y*
Functional Description ? help Back to Top
Source Description
UniProtSeems to play a role in the regulation of flowering time in the autonomous flowering pathway by repressing FLOWERING LOCUS C expression. {ECO:0000269|PubMed:10363371}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818030.0LN681803.1 Cucumis melo genomic scaffold, anchoredscaffold00026.
GenBankLN7132550.0LN713255.1 Cucumis melo genomic chromosome, chr_1.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011659347.10.0PREDICTED: homeobox protein LUMINIDEPENDENS
SwissprotQ387960.0LUMI_ARATH; Homeobox protein LUMINIDEPENDENS
TrEMBLA0A0A0K9480.0A0A0A0K948_CUCSA; Uncharacterized protein
STRINGXP_004136181.10.0(Cucumis sativus)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF98092934
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G02560.20.0HB-other family protein
Publications ? help Back to Top
  1. Ren Y, et al.
    An integrated genetic and cytogenetic map of the cucumber genome.
    PLoS ONE, 2009. 4(6): p. e5795
    [PMID:19495411]
  2. Guo S, et al.
    Transcriptome sequencing and comparative analysis of cucumber flowers with different sex types.
    BMC Genomics, 2010. 11: p. 384
    [PMID:20565788]
  3. Li Z, et al.
    RNA-Seq improves annotation of protein-coding genes in the cucumber genome.
    BMC Genomics, 2011. 12: p. 540
    [PMID:22047402]
  4. Chakrabortee S, et al.
    Luminidependens (LD) is an Arabidopsis protein with prion behavior.
    Proc. Natl. Acad. Sci. U.S.A., 2016. 113(21): p. 6065-70
    [PMID:27114519]