PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID estExt_fgenesh1_pg.C_60324
Common NameCOCSUDRAFT_47211
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Trebouxiophyceae; Trebouxiophyceae incertae sedis; Coccomyxaceae; Coccomyxa; Coccomyxa subellipsoidea
Family MYB_related
Protein Properties Length: 236aa    MW: 25315.9 Da    PI: 10.6127
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
estExt_fgenesh1_pg.C_60324genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.63.3e-143682248
                                SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
             Myb_DNA-binding  2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                ++WT+ E+++++ + k+lG g+W+ I+r +  +Rt+ q+ s+ qkyl
  estExt_fgenesh1_pg.C_60324 36 QPWTEAEHLQFLTGLKKLGRGNWRGISRLFVPTRTPTQVASHAQKYL 82
                                79*****************************9**************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.853086IPR017930Myb domain
SuperFamilySSF466891.27E-153386IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-113482IPR009057Homeodomain-like
SMARTSM007171.2E-103484IPR001005SANT/Myb domain
TIGRFAMsTIGR015573.0E-143585IPR006447Myb domain, plants
PfamPF002491.0E-113682IPR001005SANT/Myb domain
CDDcd001678.74E-113782No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000122Biological Processnegative regulation of transcription from RNA polymerase II promoter
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0030307Biological Processpositive regulation of cell growth
GO:0046686Biological Processresponse to cadmium ion
GO:0048366Biological Processleaf development
GO:2000469Biological Processnegative regulation of peroxidase activity
GO:0005634Cellular Componentnucleus
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 236 aa     Download sequence    Send to blast
MAFELPPRLR LEERKVEVAK ANNSRDSPAG NSRKGQPWTE AEHLQFLTGL KKLGRGNWRG  60
ISRLFVPTRT PTQVASHAQK YLLRQTTVSK RKSRFCLLEQ AASAQGLLCT GVADSCGAGP  120
AMLPVFYGVQ TYPVGQLSDR AGSLQGGSAS SSDTSERGCH RMLDVPSSSC PESSRAPKFT  180
KICRPVPYHA SARLTDMAKL RADLAAAVAD DKLGPLQASS RSAFFPVRPS SAISV*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00551DAPTransfer from AT5G47390Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_005648808.11e-172hypothetical protein COCSUDRAFT_47211
TrEMBLI0Z0U51e-171I0Z0U5_COCSC; Uncharacterized protein
STRINGXP_005648808.11e-172(Coccomyxa subellipsoidea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP3221529
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.13e-27MYB_related family protein
Publications ? help Back to Top
  1. Blanc G, et al.
    The genome of the polar eukaryotic microalga Coccomyxa subellipsoidea reveals traits of cold adaptation.
    Genome Biol., 2012. 13(5): p. R39
    [PMID:22630137]