PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID estExt_Genemark1.C_50268
Common NameCOCSUDRAFT_65460
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Trebouxiophyceae; Trebouxiophyceae incertae sedis; Coccomyxaceae; Coccomyxa; Coccomyxa subellipsoidea
Family SBP
Protein Properties Length: 838aa    MW: 86997.9 Da    PI: 6.9594
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
estExt_Genemark1.C_50268genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP86.14.2e-2758134177
                               --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                       SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                               +C+vegC+ +ls++  yh++ ++C++h kap+ + +gl+qrfCq+C+r hel+ f+ +krsC  +Lakhn+rrr++q
  estExt_Genemark1.C_50268  58 RCRVEGCRRELSDLSAYHQKCRICDIHIKAPSFMRAGLKQRFCQRCGRCHELDAFEGSKRSCIAQLAKHNARRRRQQ 134
                               6*************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.109.0E-2255119IPR004333Transcription factor, SBP-box
PROSITE profilePS5114124.19656133IPR004333Transcription factor, SBP-box
SuperFamilySSF1036124.84E-2458136IPR004333Transcription factor, SBP-box
PfamPF031109.9E-2559132IPR004333Transcription factor, SBP-box
CDDcd002041.57E-9580724No hitNo description
Gene3DG3DSA:1.25.40.205.2E-11583730IPR020683Ankyrin repeat-containing domain
SuperFamilySSF484032.18E-10584721IPR020683Ankyrin repeat-containing domain
PROSITE profilePS5029715.194626724IPR020683Ankyrin repeat-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 838 aa     Download sequence    Send to blast
MRKRAFGHGW YQRRAAETSG GDETAWNLHD WNWDSQNFTA TPKKGIVAAA KPCRAAKRCR  60
VEGCRRELSD LSAYHQKCRI CDIHIKAPSF MRAGLKQRFC QRCGRCHELD AFEGSKRSCI  120
AQLAKHNARR RRQQGTTAAS DDLSALSLDL ATAQSNVLES LNSRTHSLHV PMSQALPPGF  180
SYQGLMGPDV ALGIPIGVQG NMQAHTSAAM PLMMSSMQAP PTTSMVSSME QALMQMGHPS  240
AAGQLESPQE SITPEFADDK PGPIQQQPVT AASAVAAGLP AAAAYQANSL VVRLSVKLFN  300
CTPGDLPQGL REQLCNWLCA TPAGAEGYIR PGCLHLTMQV HVDAAAEVAE GVMPVVESLL  360
EQPGELWRTH RMLLQRDAEV ALVHDGQLQS VAVALSAQQP GNTQPLIREV LPKVVVCQEG  420
AHQDIAVQVT GVGLASADTT ILARCHGHYL EVQVEGEQSE GDKSLLSLRL RGPAAPGLVW  480
VETQHGVMLS PATPLLILPA GLHDLAADVL RIVSSPAKQE ASADSQRKCC DGFLADLGLV  540
ISQAGALPGP AGSTLEHPAE QLTCAAAQPG PPVTATLVTR TARHLLAFAC DAGAPALAHF  600
LLPSASVGCR SAAEVVAAVD GVEAQGGSTL LHRAARSGSG PLLRGLLAWG STNGYRWKAD  660
ARDANGLTPL HFTAIVPDAD LAVHLLLACG CSPRVWFTAA ADDGLTPAHF AARVGRNDLN  720
ERMLLLAQEA QPGSLPIKPG CGCTCGDACA CSRSGICRCA AASEGPSCGG SGGHSSDAGA  780
VSSGGQSSAG GCCGSTGSCG GTVVYADSVP SACSSSDGAL APAGNRPMSA CCVGVSL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A3e-15591321184squamosa promoter binding protein-like 4
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_005649192.10.0hypothetical protein COCSUDRAFT_65460
TrEMBLI0Z1X90.0I0Z1X9_COCSC; Uncharacterized protein
STRINGXP_005649192.10.0(Coccomyxa subellipsoidea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP550058
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G57920.15e-16squamosa promoter binding protein-like 15
Publications ? help Back to Top
  1. Blanc G, et al.
    The genome of the polar eukaryotic microalga Coccomyxa subellipsoidea reveals traits of cold adaptation.
    Genome Biol., 2012. 13(5): p. R39
    [PMID:22630137]