PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID estExt_Genemark1.C_180179
Common NameCOCSUDRAFT_67762
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Trebouxiophyceae; Trebouxiophyceae incertae sedis; Coccomyxaceae; Coccomyxa; Coccomyxa subellipsoidea
Family SBP
Protein Properties Length: 1035aa    MW: 109686 Da    PI: 5.1627
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
estExt_Genemark1.C_180179genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1148.6e-3677153177
                                --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
                        SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                                +Cqv+gC+a+l+ +keyh+r+k+Ce+h k ++++ +g++qrfCqqC+rfh+l+ fD +krsCr rL++hn+rrrkk 
  estExt_Genemark1.C_180179  77 VCQVDGCSAELTGLKEYHQRYKICEFHLKVNSIIREGKRQRFCQQCGRFHDLTSFDGDKRSCRARLQRHNARRRKKP 153
                                6*************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.106.5E-3072139IPR004333Transcription factor, SBP-box
PROSITE profilePS5114128.46275152IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.01E-3276155IPR004333Transcription factor, SBP-box
PfamPF031108.6E-3178152IPR004333Transcription factor, SBP-box
Gene3DG3DSA:1.25.40.202.1E-6668819IPR020683Ankyrin repeat-containing domain
SuperFamilySSF484031.87E-7707823IPR020683Ankyrin repeat-containing domain
PROSITE profilePS502979.49708817IPR020683Ankyrin repeat-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010321Biological Processregulation of vegetative phase change
GO:0005634Cellular Componentnucleus
GO:0016021Cellular Componentintegral component of membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1035 aa     Download sequence    Send to blast
MAENALDAKE RLWNPQDWCW DPYNMLALAS DRKGLAVAGK AVFGGLPYAV QPQLGPAASL  60
LLDDVNRSGC RGKGPAVCQV DGCSAELTGL KEYHQRYKIC EFHLKVNSII REGKRQRFCQ  120
QCGRFHDLTS FDGDKRSCRA RLQRHNARRR KKPAESGGSG AKPGVKKPPP TPLMVKGSRD  180
FVRTDSSKQR QTSDSTMDQM STPQGSLEAS SRQQMSIKSG SMESQGTIRQ LIRGGRTLPE  240
EGPSGQQLAA RLQSSSFASE QMHVTGFGDS DGAPMTAGQS SVPSSNYGDI PPSTYAADSS  300
MENLDCLQDI NFFAPQQSSP MPDYSDLNQA ATQMQATFAA DPAAMDLGQA AAASKDTTAF  360
LVEEARALLS YAGQYQALEY TAEEHFTRMS AKMFKCTPEQ LPADLKANLL AMLQCGVNAL  420
EGYIRPGCVH LTLHAMLGPD AGAALQAGCH SGMGVRALVH NLVTASNDTL WRSETLLIQW  480
YEEVALVRYG KVLHVLSASG SRGVLPRLHS VSPLAVTSAA ATTVKLIGSN IAAPDNTVLA  540
QSQGENVAIE VVSAEADMEG APEEVSSMLE VAVPAGQRNG VVHLEVARGA LLSGPKPLLI  600
LKDAAAAEEI NQLAQGDSTG LDVDGFLLDM GRVLELKNAV AAAKFGTEVH VRTFAADDVA  660
VIAQIARRQL IVAINKGWLS VARLVLPVAM ADAKSVAEAV RKLEELTDGL PLLHLAVRSQ  720
SASLVELLLE WTSVGGYELR AGTPGPHGLT ALHLAAMLKD GGKLAALLTA LCVDGATAWT  780
QAGSAGASPA DLAIAMGNHG THELVYQQLC DTMAASTKGS SDEELEDADM CDDEDYDDIE  840
VDSETGELLD LSEIICRVRG GGSDVDTLDA ALHQHTKNGE PAHVEAAAKA QPEAARTATG  900
TAEPPQHAPI HKVSPDEAGR SDGSSYTSTS RSSSDANSLL SDWPSQSCDS LGLRKRSPDV  960
PPVREGVEFT PEQKGGSKGR DADYSSLYNI GSCIGLKVAP TVFDRTSAIG SALLIAACGA  1020
LTLFFRYFGS IFLD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-2574151784squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00060PBMTransfer from AT3G60030Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_005644255.10.0hypothetical protein COCSUDRAFT_67762
TrEMBLI0YMU20.0I0YMU2_COCSC; Uncharacterized protein
STRINGXP_005644255.10.0(Coccomyxa subellipsoidea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP550058
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60030.18e-25squamosa promoter-binding protein-like 12
Publications ? help Back to Top
  1. Blanc G, et al.
    The genome of the polar eukaryotic microalga Coccomyxa subellipsoidea reveals traits of cold adaptation.
    Genome Biol., 2012. 13(5): p. R39
    [PMID:22630137]