PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Genemark1.571_g
Common NameCOCSUDRAFT_55627
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Trebouxiophyceae; Trebouxiophyceae incertae sedis; Coccomyxaceae; Coccomyxa; Coccomyxa subellipsoidea
Family SBP
Protein Properties Length: 662aa    MW: 71808.4 Da    PI: 7.3023
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Genemark1.571_ggenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP112.42.7e-3586161176
                      --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS
              SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 
                      +Cqv+gC++dls  key++r+++Ce h k ++ l +g++qrfCqqC+rfh l +fD +krsCr rL+ hn+rrrk+
  Genemark1.571_g  86 QCQVDGCNKDLSVEKEYYQRYRICEEHLKLSSLLKDGVQQRFCQQCGRFHLLADFDGDKRSCRARLDLHNNRRRKR 161
                      5*************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.106.5E-3082148IPR004333Transcription factor, SBP-box
PROSITE profilePS5114127.83884161IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.14E-3185161IPR004333Transcription factor, SBP-box
PfamPF031101.0E-3187160IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010468Biological Processregulation of gene expression
GO:0042742Biological Processdefense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 662 aa     Download sequence    Send to blast
MGDPPFEYGA PRHDWNIEDI DWDPNEVQGE LRASGSQDAS AEASSAGAAQ QVASSSGPTH  60
ESGGDVPVVL DTLQSMGSTK RRVPMQCQVD GCNKDLSVEK EYYQRYRICE EHLKLSSLLK  120
DGVQQRFCQQ CGRFHLLADF DGDKRSCRAR LDLHNNRRRK RGEAGDGSFR SSARLERRLG  180
EALHSRVSPR TRTRRVASRS RRSPLPSTDD EMTEDNSEVE QAARPRQAAS SAAEAEEGTP  240
ARERRYATRQ ATAAAMRKHS YNPALDFEKQ LYPPNIAETL AALQRGAGPH EPSQAAHSRM  300
SLQEGSSWDS SMLSAEGRQR FVAEHMLRHL SDPVQSMRDT LRQHSESGLD LRRNVLLMNS  360
LSSPTYMPSN IERSAERSAA HGSLEQDFRE SLERSSDIYQ QQGAAPLPYG GPFSEALGAT  420
GLSHYAAQLL YKCASDPVAQ DTFGRPNLPP AAIAGVHIAP GSAGGAAGGG GGSGEARRII  480
SYSSEPTSIS SSGLAKFPSE PFIRPRTVYP QYSAFDLPPG EFHDVAWPGP PNAPSAEEVK  540
HEQLSFRQGP TKRFFETAEG STQGARARSR AQQQRGEQPR RGSMDAGAAS QTAGSVLPFT  600
LPGGMAFSMG PLSSLGQSSG SGGLSRMPSA EEVVASMQRE PSTERRMGRI SLAHSLDIMQ  660
Q*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-20871601184squamosa promoter binding protein-like 4
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_005652178.10.0SBP-domain-containing protein
TrEMBLI0ZAG50.0I0ZAG5_COCSC; SBP-domain-containing protein
STRINGXP_005652178.10.0(Coccomyxa subellipsoidea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP2012101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.11e-25SBP family protein
Publications ? help Back to Top
  1. Blanc G, et al.
    The genome of the polar eukaryotic microalga Coccomyxa subellipsoidea reveals traits of cold adaptation.
    Genome Biol., 2012. 13(5): p. R39
    [PMID:22630137]