PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Genemark1.422_g
Common NameCOCSUDRAFT_55478
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Trebouxiophyceae; Trebouxiophyceae incertae sedis; Coccomyxaceae; Coccomyxa; Coccomyxa subellipsoidea
Family MYB_related
Protein Properties Length: 945aa    MW: 96925.2 Da    PI: 7.9517
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Genemark1.422_ggenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding44.92.6e-1456100147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      r +WT +E+ +++da +++G   W++I +++g  +t+ q++s+ qk+
  Genemark1.422_g  56 REKWTDQEHARFLDALRMYGRA-WRRIEEHIG-SKTAVQIRSHAQKF 100
                      789*****************88.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466894.64E-1550106IPR009057Homeodomain-like
PROSITE profilePS5129419.85951105IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.8E-753107IPR009057Homeodomain-like
TIGRFAMsTIGR015578.3E-1654103IPR006447Myb domain, plants
SMARTSM007174.2E-1155103IPR001005SANT/Myb domain
PfamPF002492.0E-115699IPR001005SANT/Myb domain
CDDcd001671.99E-758101No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0042754Biological Processnegative regulation of circadian rhythm
GO:0043433Biological Processnegative regulation of sequence-specific DNA binding transcription factor activity
GO:0046686Biological Processresponse to cadmium ion
GO:0048574Biological Processlong-day photoperiodism, flowering
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 945 aa     Download sequence    Send to blast
MSQMERSETE ERRDAETLAG LANAPSTSGG NEDRPSSSGL KRKTKTRKPY TITKQREKWT  60
DQEHARFLDA LRMYGRAWRR IEEHIGSKTA VQIRSHAQKF FSKLEKQEMS GAKGEGLPDS  120
IINIPPPRPK RKPSHPYPRK PFSGIGSYDG AGTTEGAGSQ DQMPAHARMP DYSHLAPKLK  180
GNERLDVAVA AVTQAASAAA AAAAAAVISA AGEHIRAHMQ ACPPQCFPFY GLAPSMLAQL  240
SLQQLSPQGA LQGSQSSMLP QYSAFNLAAQ TAPPAVGRPG AFSKLQRSEF SGTSADPLSA  300
PVPVRAIGRT NVDGSDGNSA CSREDPLAED GRLPGDTGAT SRQGMGVNTL SSWPSGVGLQ  360
QQAAMQQQWS PEMLSELYYN WNNMTSLSAA AAGASGGVEA AAATKDSNWR AVVQAAAAAA  420
SQWEVQKLSG LQHRDSGMGQ TQSVSAQAMG KDKTLPVQNI ASRSALRGNK VHSLELKARR  480
QGLSGSDGSG TNAAEGRVDA ACANVGNPDA GDEDSPSRNF DDSLYQPLGK KGAMGSLDTN  540
NSDLDTGMKG EGELAYQVDA EGEGSGSNPT GNGESGNNSN GNSGGEGKRG SNKGSNSGSG  600
NDTDPCDKDV IGTSKEPAAA APPQSVRESI AGNDAGGSGG TNGTGSGSGN ATRISNGATV  660
PTGLSKREGS DEGCTSLEHP QPRAHGVGSS EPADPAAAAA AAAAAAAFLA QQPAAAAAPD  720
FSALNGAQGL MDTAQMAQAA SALQQSGLAP YLLQQQYNAQ IVQLQQAAMM NWGGQKMSAL  780
DMFSSIMGFQ ALAGQQAGHL QAPALRPRPS AIPANSAGAR ELLSAQSGMA SFDAMPHAPG  840
MVPWASADVG AGLADAAALP TAASGVLPRP GKPPVGAGAG ADSVSVSGHA HQSQGFMPYK  900
WRHHPLPRGV HQLQPGGLLS LGKRSASASL AEPARKRALS GNLP*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00119DAPTransfer from AT1G01060Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_005652015.10.0hypothetical protein COCSUDRAFT_55478
TrEMBLI0ZA020.0I0ZA02_COCSC; Uncharacterized protein
STRINGXP_005652015.10.0(Coccomyxa subellipsoidea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP4541427
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01060.43e-31MYB_related family protein
Publications ? help Back to Top
  1. Blanc G, et al.
    The genome of the polar eukaryotic microalga Coccomyxa subellipsoidea reveals traits of cold adaptation.
    Genome Biol., 2012. 13(5): p. R39
    [PMID:22630137]