PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Genemark1.3253_g
Common NameCOCSUDRAFT_62470
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Trebouxiophyceae; Trebouxiophyceae incertae sedis; Coccomyxaceae; Coccomyxa; Coccomyxa subellipsoidea
Family MYB_related
Protein Properties Length: 519aa    MW: 55002.8 Da    PI: 9.5419
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Genemark1.3253_ggenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding32.42.2e-10261302245
                       SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
   Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                        rW++e+ el+++a +++G++ +++I r+++ gR +k +k+++q
  Genemark1.3253_g 261 ERWSAEDTELFYKALRLFGTD-FTLIERMFP-GRQRKALKNKLQ 302
                       59*******************.*********.**********99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF159631.5E-21253337No hitNo description
SuperFamilySSF466894.56E-8255302IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.3E-5258301IPR009057Homeodomain-like
SMARTSM007171.5E-6259307IPR001005SANT/Myb domain
CDDcd001672.22E-5262300No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 519 aa     Download sequence    Send to blast
MLRGRGLPLR HFQQQKLCQP QQKPQGLLHP VPLRQMFLAH PRNPQQLHSD GSLWAMTFLA  60
HWGQSPLLLG KPKGKQAAAP EEEAGPSSPA AAERSSRAVP AAVGVEDRTL VILPDQQRQD  120
ADGEAAAPAG KGRKGRARKA VAATAPLDVS TMSLKSIIKC AYAKERARLD EEKRKKEEEE  180
KLTQEAGGSQ VPVAAAAPVA ASPQPSAAGL APRVEVVDGR MRIVEQSLSI QAQPEAAGRL  240
ITVEDNPKLN NLTYARRMNN ERWSAEDTEL FYKALRLFGT DFTLIERMFP GRQRKALKNK  300
LQREYRADFA RVDSALSGGG AASQESLKEV VALLKQHTED QENTGVVDGS GEEQRPDLTA  360
ALLGRSQADD AEAAEADAGA ENDDVLALPA PPVQNGGTQR ARTKASQRRP KQPATETHPE  420
ASAAPGEPAS AAAEVAIAAP PVAPQVADGD GPASAPPRRK VLPRVPARGR KRPEASAPAA  480
GDGSNGEEAV AADGSAVIHE ARPRLTRQRA AAGASSVE*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1163175KERARLDEEKRKK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_005648486.10.0hypothetical protein COCSUDRAFT_62470
TrEMBLI0YZX30.0I0YZX3_COCSC; Uncharacterized protein
STRINGXP_005648486.10.0(Coccomyxa subellipsoidea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP377099
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G39160.26e-12MYB_related family protein
Publications ? help Back to Top
  1. Blanc G, et al.
    The genome of the polar eukaryotic microalga Coccomyxa subellipsoidea reveals traits of cold adaptation.
    Genome Biol., 2012. 13(5): p. R39
    [PMID:22630137]