PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Genemark1.2708_g
Common NameCOCSUDRAFT_61925
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Chlorophyta; Trebouxiophyceae; Trebouxiophyceae incertae sedis; Coccomyxaceae; Coccomyxa; Coccomyxa subellipsoidea
Family SBP
Protein Properties Length: 1381aa    MW: 141268 Da    PI: 8.6158
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Genemark1.2708_ggenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP83.52.8e-26149223478
                       STT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
               SBP   4 vegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                       ve+C+ d+ e+ +yh r+++C+vh + p+ + +g+ qrfCqqC+r helsef+ ++rsCr +L++hn+rrr++++
  Genemark1.2708_g 149 VEDCTRDVCELSTYHFRYRICNVHIRLPAFMRQGKLQRFCQQCGRCHELSEFEGSQRSCRAQLDRHNARRRQAKK 223
                       99*********************************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114122.401144221IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.102.0E-19148208IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.31E-22149224IPR004333Transcription factor, SBP-box
PfamPF031102.2E-23149220IPR004333Transcription factor, SBP-box
PROSITE profilePS510077.282177317IPR009056Cytochrome c-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0009055Molecular Functionelectron carrier activity
GO:0020037Molecular Functionheme binding
Sequence ? help Back to Top
Protein Sequence    Length: 1381 aa     Download sequence    Send to blast
MPAAAAAAMK FTSDGDTAAG VAKPRWRPCV RAVGVLCRGW WRTAVPGTEQ SDALSVLGSA  60
RAKEVRPYRH QAPRLKRTAP RPCSVPEAPF EQVKPFGMRL DLLHRSSSGL SSDRGQAVPQ  120
LLTLQRSLAL PLLLNAPNGL QRQDRGPAVE DCTRDVCELS TYHFRYRICN VHIRLPAFMR  180
QGKLQRFCQQ CGRCHELSEF EGSQRSCRAQ LDRHNARRRQ AKKNAAAAKG PGAGSAAHAA  240
GASASGQYSS STSLPASSSG GGGAVPRGGR SGAGEAGLLG PRRSRDPALS AAAAGLFSGA  300
DDEDAAADAA TLLSVSQPRP ALLPQPEQQP SASRLGSSRL SAFAQYSGEP AVGDAATAAR  360
TGSGAMRAVT PTDASERRLG SQMLRQGSEK SRQQQITSSS ESAAAGVYDT SPGRADAEEA  420
TSQARRQSHS VGEEAASLEP AVRRRSGNLP AHGNERVGSA PGPSGKTSPS PGAASRFLDS  480
AAAQGFAAVL SRAAAAALQE AAAEQPPKMH DIVPGVAAGV QMGPIEPQPT PFSALASASL  540
SEAPTTQLSI SPRAPEAMSA TFPPSVSPAA ATAAVDLKSG IQASRSLSES MLPGESPPSW  600
AGTAKRTASV ARPLDRSGLM SATGAPSVSN SAAGSAELLA ARSRLALERN AMVLRGLQQS  660
MAADGSGRKV SSSASIALTQ RGNSTQSSMD LYVPDAAAAA AASASGADAA AARLPSADKS  720
PNRPPPFPQP PRGGQPGRAA QGEASPQQQE PYEDAVRHWL HFGQQIAAST KPGPQGLLPH  780
SLGLQAVNYL AGEVGAAAAS AEAGVQELPL PVQLAGKEDR QVLAGSLPEG LRTALGLSMG  840
QPVGQPQRKG THIDAPALAA AGEGPGAAVA PPSLLSQAEA AAAAAAQPSQ TVQAQLAASA  900
AAAAAQQSLY LPMARSTAQI GMAGADQAGA AAAAVAGAAQ LQAANPLSYQ FYQMLLGSMA  960
SAAPKQQLQQ QQAAFLENVA AANAAALLSF RAEAFAVHLC VKLFHCTPAD LPEDAREQLL  1020
GWLKGAPACT ELYIRSGCVH LTVTAYVDVV TYQQVLANGA AQAAHHLIAQ ASQVWRRGVM  1080
LVEVMNRAVL VSDGVPGPEF GLDAVCSGAF SRVEPPVAMA GQVCVLEAHG GPAAADIADS  1140
AVLCRANGRY YDTQVEEVTG LAAGAGRKFF VRLPPDIPPG VIYLELQHGP FVGGACPALV  1200
MPPERAAAAV ELLQALRARD ALLKGGWLPA DQCLAISRAT TDALLCQMGL VMRALSHGTS  1260
DVAPSSALPR PEGVPEALVL VSSLQQPASA ALAYGMLQFA CTWGLPHLSS FLLQSISLDR  1320
STSAAVGMQQ PSPLTVSTGA SAGKDWTVSV PHSVMGGSGL DVLAKLAAQI GQQTVPAGQA  1380
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-161492201384squamosa promoter binding protein-like 4
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_005649040.10.0hypothetical protein COCSUDRAFT_61925
TrEMBLI0Z1H70.0I0Z1H7_COCSC; Uncharacterized protein
STRINGXP_005649040.10.0(Coccomyxa subellipsoidea)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
ChlorophytaeOGCP2012101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.18e-18SBP family protein
Publications ? help Back to Top
  1. Blanc G, et al.
    The genome of the polar eukaryotic microalga Coccomyxa subellipsoidea reveals traits of cold adaptation.
    Genome Biol., 2012. 13(5): p. R39
    [PMID:22630137]