PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK29842.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family NF-YB
Protein Properties Length: 165aa    MW: 18590.8 Da    PI: 5.7301
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK29842.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB162.27.3e-5128122397
      NF-YB   3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 
                +++r+lPianv+r+mk++lP nakisk+aket+qecvsef+sfvt+eas+kc+re+rkt+ngdd++wala lGf++y+ plk yl++yrele ek
  PK29842.1  28 QDQRLLPIANVGRMMKQILPPNAKISKEAKETMQECVSEFVSFVTGEASEKCRRERRKTVNGDDVCWALAALGFDEYAGPLKRYLHRYRELEVEK 122
                56799**************************************************************************************9886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.8E-4726133IPR009072Histone-fold
SuperFamilySSF471132.17E-3729139IPR009072Histone-fold
PfamPF008085.3E-263296IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.5E-166078No hitNo description
PRINTSPR006151.5E-167997No hitNo description
PRINTSPR006151.5E-1698116No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 165 aa     Download sequence    Send to blast
MDKSIIGAGV SSNYNESSSD GVNRLVDQDQ RLLPIANVGR MMKQILPPNA KISKEAKETM  60
QECVSEFVSF VTGEASEKCR RERRKTVNGD DVCWALAALG FDEYAGPLKR YLHRYRELEV  120
EKSSSSININ NNNNNNNNLM VIRLNDQNIP AFHHYVSPND DDALL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5g49_A1e-4021117197NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtComponent of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021820118.13e-60nuclear transcription factor Y subunit B-5
SwissprotO822486e-53NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
TrEMBLA0A2P5ERX24e-66A0A2P5ERX2_TREOI; Nuclear transcription factor Y subunit B
STRINGevm.model.supercontig_287.45e-59(Carica papaya)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80532131
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47810.16e-55nuclear factor Y, subunit B5
Publications ? help Back to Top
  1. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]