PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK29811.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family LBD
Protein Properties Length: 136aa    MW: 14565.2 Da    PI: 4.7012
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK29811.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26033.11.6e-102425797
     DUF260 57 amsslvyeAearardPvyGavgvilklqqqleqlkaelall 97
               +++sl+yeA  r+ +Pv+Gavg+++ ++++++q+++e++l+
  PK29811.1  2 LFQSLLYEAVGRTVNPVNGAVGLLWMGNWHVCQAAVETVLR 42
               799********************************999876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508918.749146IPR004883Lateral organ boundaries, LOB
PfamPF031959.3E-7240IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 136 aa     Download sequence    Send to blast
ALFQSLLYEA VGRTVNPVNG AVGLLWMGNW HVCQAAVETV LRGGALGTLS ESSSADHPTV  60
SRRRWPKKRP CSTVNNFDEG TSDPYGLEPS DLDLCLMAAG TKMEKKISRE VSPTSEEGSE  120
TTTLGSNSVD SDTYLG
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007199277.14e-32hypothetical protein PRUPE_ppa022806mg
TrEMBLM5VIB14e-32M5VIB1_PRUPE; Uncharacterized protein
STRINGGSMUA_Achr3P30130_0012e-24(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF72134136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G49940.14e-25LOB domain-containing protein 38