PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK29337.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family MYB
Protein Properties Length: 292aa    MW: 33572.4 Da    PI: 5.6289
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK29337.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.13.2e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+W++eEd++l  +v+++G  +W+  ++  g+ R++k+c++rw +yl
        PK29337.1 14 RGAWSPEEDDKLRAYVERYGHWNWRELPKFAGLSRCGKSCRLRWMNYL 61
                     89******************99************************97 PP

2Myb_DNA-binding58.21.9e-1867112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+ T+eE+  ++++++q+G++ W+ Ia++++ gRt++++k++w+++l
        PK29337.1  67 RGNYTAEEENTIIKLHQQHGKK-WSMIAAKLP-GRTDNEIKNHWHTHL 112
                      899*******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.782961IPR017930Myb domain
SuperFamilySSF466892.55E-3011108IPR009057Homeodomain-like
SMARTSM007176.6E-131363IPR001005SANT/Myb domain
PfamPF002497.8E-151461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.1E-231568IPR009057Homeodomain-like
CDDcd001673.46E-101661No hitNo description
PROSITE profilePS5129426.71462116IPR017930Myb domain
SMARTSM007179.0E-1766114IPR001005SANT/Myb domain
PfamPF002496.9E-1667112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-2669115IPR009057Homeodomain-like
CDDcd001671.34E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MVRAPFIDEN GVKRGAWSPE EDDKLRAYVE RYGHWNWREL PKFAGLSRCG KSCRLRWMNY  60
LRPDVRRGNY TAEEENTIIK LHQQHGKKWS MIAAKLPGRT DNEIKNHWHT HLKKRAINNN  120
NTEHNHDDDD DDDENPTKSQ HSSGLYSSGC DNHNLNHDHG ESSEAQSSSS SSTITDHVSP  180
QILESSQYSS APSPHNNNNI NSTTGKYCSS TDVGIVLHES LLSDHYEEYD SFWTEPFVED  240
NKVIMPIQDD HQYYYSTTYF GDSEANNIAS FYNLSLYNIT DDQGMAKTSY II
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-22141167108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010095860.15e-81Myb-related protein Myb4
TrEMBLW9R8A15e-81W9R8A1_9R
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF35633186
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G79180.12e-57myb domain protein 63