PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK29334.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family LBD
Protein Properties Length: 65aa    MW: 7353.12 Da    PI: 5.8113
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK29334.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26088.58.6e-282651578
     DUF260 15 dCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavg 78
                C++apyf +++pkkfa vhk+FGasnv+k+l ++pee+red+++sl+yeAear+rdPvyG++g
  PK29334.1  2 TCIFAPYFRSDEPKKFAKVHKVFGASNVSKILIEVPEEQREDTVNSLAYEAEARLRDPVYGCIG 65
               6*************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089118.73165IPR004883Lateral organ boundaries, LOB
PfamPF031956.2E-27265IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 65 aa     Download sequence    Send to blast
XTCIFAPYFR SDEPKKFAKV HKVFGASNVS KILIEVPEEQ REDTVNSLAY EAEARLRDPV  60
YGCIG
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010067552.11e-40PREDICTED: LOB domain-containing protein 21 isoform X1
RefseqXP_010067553.19e-41PREDICTED: LOB domain-containing protein 21 isoform X2
RefseqXP_012457488.18e-41PREDICTED: LOB domain-containing protein 21-like isoform X3
SwissprotQ9SRL83e-34LBD21_ARATH; LOB domain-containing protein 21
TrEMBLA0A059BI259e-41A0A059BI25_EUCGR; Uncharacterized protein
TrEMBLA0A0D2UZ739e-41A0A0D2UZ73_G
STRINGPOPTR_0010s19340.13e-39(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59443353
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11090.12e-35LOB domain-containing protein 21