PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK29071.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family MYB
Protein Properties Length: 258aa    MW: 28677.4 Da    PI: 8.6326
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK29071.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.33.5e-184186147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W+teEd +l ++v ++G ++W++I+r++  gR++k+c++rw + 
        PK29071.1 41 KGPWSTEEDRILTRLVDRYGARNWSLISRYIK-GRSGKSCRLRWCNQ 86
                     79*****************************9.***********985 PP

2Myb_DNA-binding56.66e-1895137347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++++ Ede ++ a++q+G++ W+tIar ++ gRt++ +k++w++ 
        PK29071.1  95 PFSPAEDETILAAHAQYGNR-WATIARLLP-GRTDNAVKNHWNST 137
                      79******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.7533691IPR017930Myb domain
SuperFamilySSF466894.67E-3138134IPR009057Homeodomain-like
SMARTSM007172.3E-154089IPR001005SANT/Myb domain
PfamPF002495.7E-174186IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.0E-244294IPR009057Homeodomain-like
CDDcd001673.46E-144385No hitNo description
SMARTSM007171.3E-1592140IPR001005SANT/Myb domain
PROSITE profilePS5129421.26993142IPR017930Myb domain
PfamPF002491.3E-1495137IPR001005SANT/Myb domain
CDDcd001672.51E-1295138No hitNo description
Gene3DG3DSA:1.10.10.604.9E-2395141IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 258 aa     Download sequence    Send to blast
MEAMNYNRCT SSTTSSSDSS SSESSGNNKV PRNGNKPERI KGPWSTEEDR ILTRLVDRYG  60
ARNWSLISRY IKGRSGKSCR LRWCNQLSPS VEHRPFSPAE DETILAAHAQ YGNRWATIAR  120
LLPGRTDNAV KNHWNSTLKR RAREAHQMED EGNQNTMSCG TGFSRGEANG SLPFGNTSNS  180
ITNNNSDNNV NGHSSPMSVE NDPPTALTLA PPGRGGDVMP EERRESFTAG FWDVMRDVIA  240
REVREYVSTT LSDNSGFR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-41371423108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015885414.11e-100PREDICTED: transcription factor MYB44-like
TrEMBLA0A067KQI32e-97A0A067KQI3_JATCU; MYB family protein
STRINGPOPTR_0002s13030.12e-90(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF50743256
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50060.19e-57myb domain protein 77