PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK28796.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family Dof
Protein Properties Length: 195aa    MW: 22326.1 Da    PI: 10.4181
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK28796.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof127.44.3e-4050111263
     zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63 
                k++a++cprC+stntkfCyynnysl+qPryfCk+CrryWt+GG+lrnvPvGgg+rknk+sss
  PK28796.1  50 KDQAVNCPRCNSTNTKFCYYNNYSLTQPRYFCKTCRRYWTEGGSLRNVPVGGGSRKNKRSSS 111
                7899******************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-2943108IPR003851Zinc finger, Dof-type
PfamPF027017.5E-3451108IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.00354108IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105692IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 195 aa     Download sequence    Send to blast
XNNNNNNNKP RMELGSNNNN SSNDIIIKSN SNNNMLGSSD QRRNITRPQK DQAVNCPRCN  60
STNTKFCYYN NYSLTQPRYF CKTCRRYWTE GGSLRNVPVG GGSRKNKRSS SSSPSPLTTS  120
SPPSSSSSLQ TKKLHHHHDL LPLPFTFPNI ITHQQQQQQQ QQQQQQNPKS NQGQDLNLTF  180
PPQPSDHHYH HHHHH
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_023912132.19e-52dof zinc finger protein 1-like isoform X1
RefseqXP_023912133.16e-52dof zinc finger protein 1-like isoform X2
SwissprotQ8LAP81e-41DOF46_ARATH; Dof zinc finger protein DOF4.6
TrEMBLA0A2P5DFE17e-49A0A2P5DFE1_PARAD; Zinc finger transcription factor
STRINGVIT_16s0098g01420.t011e-46(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF67434137
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24060.12e-39Dof family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]