PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK28773.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family MYB
Protein Properties Length: 326aa    MW: 37458.8 Da    PI: 9.1257
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK28773.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding513.3e-1685130147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg W + Ed +l+++v+q+G+ +W++Ia+ +  gR++k+c++rw++ 
        PK28773.1  85 RGHWRPIEDAKLKELVTQYGPQNWNLIAENLE-GRSGKSCRLRWFNQ 130
                      899*****************************.***********996 PP

2Myb_DNA-binding53.26.7e-17137180146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      r ++++eE+e+l+ a++++G++ W+ Iar ++ gRt++ +k++w+ 
        PK28773.1 137 RRAFSEEEEERLLGAHRLYGNK-WAMIARLFP-GRTDNAVKNHWHV 180
                      678*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.08480131IPR017930Myb domain
SMARTSM007171.1E-1384133IPR001005SANT/Myb domain
PfamPF002491.3E-1485130IPR001005SANT/Myb domain
SuperFamilySSF466892.7E-2785178IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.2E-2586138IPR009057Homeodomain-like
CDDcd001671.37E-1188129No hitNo description
PROSITE profilePS5129426.075132186IPR017930Myb domain
SMARTSM007171.9E-13136184IPR001005SANT/Myb domain
PfamPF002491.1E-13137179IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.9E-20139185IPR009057Homeodomain-like
CDDcd001677.26E-10139179No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0051782Biological Processnegative regulation of cell division
GO:0071367Biological Processcellular response to brassinosteroid stimulus
GO:0005634Cellular Componentnucleus
GO:0001046Molecular Functioncore promoter sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
KNMSFIPSPP QLSLFKTSCD EMGFQILSSS SEKTKKEWIF PNQMENREEK RISDLNVFDE  60
IPEREEIRIR TTSGVKNVHT KLCARGHWRP IEDAKLKELV TQYGPQNWNL IAENLEGRSG  120
KSCRLRWFNQ LDPRINRRAF SEEEEERLLG AHRLYGNKWA MIARLFPGRT DNAVKNHWHV  180
IMARKHREQS NVYKRRRPSS SSTSSSCHSQ ILVPKVIDMT LSTNNNDHNY NNGSSTTEST  240
ISNTINDHES ISTCTELSLT PSSTSHHYGL KNGSFDKLLS LYKRRVGIGQ SDSNSENSAE  300
YYSVATNKSI NLTMFDPNQS QNIKED
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-32841856107B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00516DAPTransfer from AT5G17800Download
Motif logo
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKM0346329e-59KM034632.1 Jatropha curcas clone JcMYB011 MYB family protein gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010088473.11e-107Transcription factor
TrEMBLW9R1G41e-107W9R1G4_9R
STRINGPOPTR_0019s05740.14e-95(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF23034243
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69560.15e-71myb domain protein 105