PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK28187.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family MYB
Protein Properties Length: 421aa    MW: 47669.2 Da    PI: 6.6914
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK28187.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.33.5e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEd++lvd+++++G g+W+t ++  g+ R +k+c++rw +yl
        PK28187.1 14 KGPWTPEEDQKLVDYIQKHGYGNWRTLPKNAGLQRRGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding54.23.4e-1767111147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rgr++ eE+e +++++  lG++ W++Ia++++ gRt++++k++w+++
        PK28187.1  67 RGRFSFEEEETIIQLHSILGNK-WSAIAARLP-GRTDNEIKNYWNTH 111
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.1E-25564IPR009057Homeodomain-like
PROSITE profilePS5129417.702961IPR017930Myb domain
SuperFamilySSF466891.24E-3111108IPR009057Homeodomain-like
SMARTSM007174.3E-131363IPR001005SANT/Myb domain
PfamPF002495.5E-161461IPR001005SANT/Myb domain
CDDcd001674.57E-121661No hitNo description
PROSITE profilePS5129425.25562116IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.9E-2665116IPR009057Homeodomain-like
SMARTSM007171.8E-1666114IPR001005SANT/Myb domain
PfamPF002491.5E-1567111IPR001005SANT/Myb domain
CDDcd001673.34E-1269112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009611Biological Processresponse to wounding
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 421 aa     Download sequence    Send to blast
MGRAPCCDKN GLKKGPWTPE EDQKLVDYIQ KHGYGNWRTL PKNAGLQRRG KSCRLRWTNY  60
LRPDIKRGRF SFEEEETIIQ LHSILGNKWS AIAARLPGRT DNEIKNYWNT HIRKRLLRMG  120
IDPVTHSPRL DLLDLSSILS SSFYNSSHHH QMSHMSRFLG VQPAAVMNPE LLKLATSLMS  180
SSNNNNSQQR GNTSSSTNNQ NSNTTTFYFQ NSQQEVVDHQ NQLYNNINQF QQQVLYQPNQ  240
LHEISQPGCP TTTTSTLDHV SCAPLSNDEL VHQDLSNFTN FSSPSSQISH EWQSSSTTTT  300
TTTTTNGMPS NFTEADHYAP SLPGYSSYST YHDNHYHHQQ PTVIDPSTES YQSNQNFSFT  360
TTTSVLSTPS SSPTALNSNN STNYLNSTTC STEDEPESYC SSMLKFEISD ILDVNEFNYV  420
M
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-30121165108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008224927.11e-150PREDICTED: transcription repressor MYB6-like
TrEMBLM5WTM31e-148M5WTM3_PRUPE; Uncharacterized protein
STRINGPOPTR_0004s03310.11e-136(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF85034127
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G21440.18e-91MYB-like 102