PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK28107.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family GRF
Protein Properties Length: 353aa    MW: 39437.6 Da    PI: 8.3829
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK28107.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC79.14.3e-2580124145
        WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                d+epgrCrRtDGKkWRCs+++++++k+CErH+hrgr+rsrk++e 
  PK28107.1  80 DPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVEV 124
                79****************************************985 PP

2QLQ58.51.9e-201449136
        QLQ  1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36
               s+FTa+Q+q+L++Q+l++Ky+++++P+P++L+  ++
  PK28107.1 14 SPFTATQWQELEHQALIFKYMVSGVPIPSDLIYSVK 49
               89*****************************87665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009513.6E-111450IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.6E-141547IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166621.5551550IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.32580124IPR014977WRC domain
PfamPF088793.2E-2181123IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MISPNSSAAA RNRSPFTATQ WQELEHQALI FKYMVSGVPI PSDLIYSVKR SLDSTFSSRL  60
FSQHPTGWGC FEMGFGRKVD PEPGRCRRTD GKKWRCSKEA YPDSKYCERH MHRGRNRSRK  120
PVEVSSNTTT MLSPSSTTPM QTPSPSISSV NRNLPGTGPT ISSYSQLSSS SIMCEPLSGA  180
HNNPHNNPSA YPFVYSHSSS SRPPDYGLSP QNNTSSPYFC LKPEPDKDYR YFQGSKESMD  240
ELAFFPESSG NARSFPDSCH SLLNSYRGYS HPQFQGLTDE SKEAIKQSAD QDQQHCFILG  300
TDFKSERGIN KTGKESETQK PLHHFFGEWP PKNTAAADSW LDLASNSRVP NDG
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150423e-62AP015042.1 Vigna angularis var. angularis DNA, chromosome 9, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010086824.10.0hypothetical protein L484_009597
TrEMBLW9QWS90.0W9QWS9_9R
STRINGGLYMA07G04290.11e-126(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF97443137
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.13e-58growth-regulating factor 5