PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK27708.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family MYB
Protein Properties Length: 447aa    MW: 48963.3 Da    PI: 5.0617
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK27708.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding543.7e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WTteEd++l  +++q+G g W++ +++ g+ R++k+c++rw +yl
        PK27708.1 14 KGAWTTEEDQKLSAYITQHGEGGWRSLPEKAGLSRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding48.71.8e-1567110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg +T eE+e + ++++ lG++ W++Ia+ ++  Rt++++k++w++
        PK27708.1  67 RGEFTNEEEETIMRLHAVLGNK-WSAIAKQLP-MRTDNEIKNHWNT 110
                      899*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.1E-22564IPR009057Homeodomain-like
PROSITE profilePS5129415.642961IPR017930Myb domain
SuperFamilySSF466894.87E-2811108IPR009057Homeodomain-like
SMARTSM007172.6E-121363IPR001005SANT/Myb domain
PfamPF002495.1E-141461IPR001005SANT/Myb domain
CDDcd001678.43E-91661No hitNo description
PROSITE profilePS5129424.31262116IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.8E-2565114IPR009057Homeodomain-like
SMARTSM007171.2E-1366114IPR001005SANT/Myb domain
PfamPF002493.4E-1467110IPR001005SANT/Myb domain
CDDcd001673.59E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 447 aa     Download sequence    Send to blast
MGRTPCCNVQ GLKKGAWTTE EDQKLSAYIT QHGEGGWRSL PEKAGLSRCG KSCRLRWTNY  60
LRPGIKRGEF TNEEEETIMR LHAVLGNKWS AIAKQLPMRT DNEIKNHWNT RLKRIVAEKG  120
KDNLITRADI ENLVAKNGIG NNAETEKSPM KNLNVVESKG STFKLLNDVA SKLKASGSIV  180
SLINQQVVKC NSTEANSVSS PTNTTTTTST TANTPANLLN RVATTLNSPK SNSLGAIKAI  240
FSRTLEGSTV SGSSDNSFSE VGMGIEDTSD ERSSPESENA VHVSIPFSSS TRLLNKMASK  300
FALMNHVQTV AGGSTHMSKP PVLEPNHLDD WSQEISHLGG ISGTCKDETS NQFDMVFEPD  360
HQDEFLLEVG CEDQKDKGKV CNEDNELIRS LSRETDSNEQ VLVFTSNSSS SYEGSSHIEV  420
VVSDLEAADN WEDCVNFDEF FDAATLE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A9e-2791162108B-MYB
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
STRINGGLYMA04G33210.12e-66(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF2559633
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74080.12e-65myb domain protein 122