PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK27693.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family MYB
Protein Properties Length: 310aa    MW: 35254.3 Da    PI: 9.5671
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK27693.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding28.73.2e-092873346
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrwqk 46
                     +WT+eE +++ +a + + ++   +W ++a++++ g+t  ++   ++ 
        PK27693.1 28 KWTPEENKRFENALAVYDKDtpdRWVKVAEMIP-GKTVGDVMKQYRE 73
                     7********************************.****999998875 PP

2Myb_DNA-binding46.11.1e-14137181347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ +++ + k++G+g+W+ I+r + ++Rt+ q+ s+ qky
        PK27693.1 137 PWTEEEHRQFLLGLKKYGKGDWRNISRNFVTTRTPTQVASHAQKY 181
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.6E-52274IPR009057Homeodomain-like
PROSITE profilePS512939.1312479IPR017884SANT domain
SMARTSM007177.5E-102577IPR001005SANT/Myb domain
CDDcd001676.42E-82874No hitNo description
SuperFamilySSF466896.1E-122881IPR009057Homeodomain-like
PfamPF002491.3E-72873IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-12128185IPR009057Homeodomain-like
PROSITE profilePS5129420.205130186IPR017930Myb domain
SuperFamilySSF466891.93E-17132185IPR009057Homeodomain-like
TIGRFAMsTIGR015579.3E-18133185IPR006447Myb domain, plants
SMARTSM007173.5E-13134184IPR001005SANT/Myb domain
CDDcd001676.75E-11137182No hitNo description
PfamPF002494.1E-12137181IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 310 aa     Download sequence    Send to blast
MYRGIELLSP ATYLQNSNWL FQESKAAKWT PEENKRFENA LAVYDKDTPD RWVKVAEMIP  60
GKTVGDVMKQ YRELEEDVSD IEAGLIPIPG YSTTTNSFTL EWVNNQGFEG LKQFYSVGGK  120
RGANTRPSDQ ERKKGVPWTE EEHRQFLLGL KKYGKGDWRN ISRNFVTTRT PTQVASHAQK  180
YFIRQVTGGK DKRRSSIHDI TTVNLPESKS PSSENGRSPP SPDHSVPVMQ PNLAKQQQQQ  240
QQYDWKPSNE SLPMVFNQLN SNAYGGPFCG ISSYKSKLQE QNLLSGNLRG SQFGAYSSST  300
LYQMQSMHHQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A4e-1729941176RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00296DAPTransfer from AT2G38090Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010109645.11e-178Transcription factor
SwissprotQ8S9H71e-116DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLW9SDH41e-178W9SDH4_9R
STRINGPOPTR_0016s11980.11e-165(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF46634162
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.11e-122MYB family protein