PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK27552.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family NF-YB
Protein Properties Length: 155aa    MW: 17390.7 Da    PI: 4.3198
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK27552.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB74.71.4e-231194386
      NF-YB  3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvy 86
               ++d+ lP a +++i+k++lP + ++++da++++ ec +efi +++se+++ c re+++ti+++ +l al  lGf +y+e++ + 
  PK27552.1 11 KEDASLPKATMTKIIKEMLPPDVRVARDAQDLLIECCVEFINLISSESNEVCGREEKRTIAPEHVLKALEVLGFGEYIEEVYAA 94
               6899***************************************************************************98654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.2E-398139IPR009072Histone-fold
SuperFamilySSF471132.85E-3512140IPR009072Histone-fold
PfamPF008082.4E-211479IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 155 aa     Download sequence    Send to blast
MDPMDIVGKS KEDASLPKAT MTKIIKEMLP PDVRVARDAQ DLLIECCVEF INLISSESNE  60
VCGREEKRTI APEHVLKALE VLGFGEYIEE VYAAYEQHKL ETMQDLRSGK WSNGAEMTEE  120
EALAEQQRMF AEARARMNGG TATPKQPEPD QSLES
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_B2e-351213412133Transcription Regulator NC2 beta chain
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024030766.11e-110protein Dr1 homolog
SwissprotP495925e-93NC2B_ARATH; Protein Dr1 homolog
TrEMBLA0A2P5F4R61e-106A0A2P5F4R6_TREOI; Nuclear transcription factor Y subunit B
TrEMBLW9SUR91e-106W9SUR9_9ROSA; Protein Dr1-like protein
STRINGXP_010110772.11e-106(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47663358
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23090.22e-95nuclear factor Y, subunit B13
Publications ? help Back to Top
  1. Zhao H, et al.
    The Arabidopsis thaliana Nuclear Factor Y Transcription Factors.
    Front Plant Sci, 2016. 7: p. 2045
    [PMID:28119722]