PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK27389.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family LBD
Protein Properties Length: 246aa    MW: 26709 Da    PI: 5.5967
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK27389.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260134.73.4e-42581571100
     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                +CaaCk+lrr+Ca++Cvlapyfp ++p+kf ++h++FGasn++k+l++lpe++r da+ss+vyeA ar+rdPvyG++g i +lq+q+ +l+a+la++++e
  PK27389.1  58 PCAACKILRRRCADKCVLAPYFPPTEPAKFTIAHRVFGASNIIKFLQELPESQRADAVSSMVYEAGARIRDPVYGCAGAICQLQKQVGELQAQLAKAQAE 157
                7**********************************************************************************************99976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.87957158IPR004883Lateral organ boundaries, LOB
PfamPF031953.2E-4258155IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 246 aa     Download sequence    Send to blast
MECSTETNTT TTTSSSPPLA AASQYSSNSS SSSPDHQQHL QTLNPNPNPV ATPVVLSPCA  60
ACKILRRRCA DKCVLAPYFP PTEPAKFTIA HRVFGASNII KFLQELPESQ RADAVSSMVY  120
EAGARIRDPV YGCAGAICQL QKQVGELQAQ LAKAQAEVVN MQCQQANLVA ILCMEMAQSQ  180
QGFNNNNNNN LLSPQQNSLV IDHGLMINNN NNTTTTPLMI SNQNNNNSLS FLDDINLGSL  240
WEPLWT
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010104136.11e-105hypothetical protein L484_014422
SwissprotQ9SK088e-75LBD11_ARATH; LOB domain-containing protein 11
TrEMBLW9SCB71e-105W9SCB7_9R
STRINGGLYMA13G40370.22e-87(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.12e-63LOB domain-containing protein 11