PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK26086.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family Dof
Protein Properties Length: 378aa    MW: 41383.2 Da    PI: 7.7942
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK26086.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1239.8e-3964121562
     zf-Dof   5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                alkcprCds+ntkfCyynny+lsqPr+fCkaC+ryWt+GG+lrnvPvGgg+rknk+++
  PK26086.1  64 ALKCPRCDSSNTKFCYYNNYNLSQPRHFCKACKRYWTRGGTLRNVPVGGGCRKNKRVK 121
                689****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-2764119IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.68365119IPR003851Zinc finger, Dof-type
PfamPF027012.0E-3365119IPR003851Zinc finger, Dof-type
PROSITE patternPS01361067103IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 378 aa     Download sequence    Send to blast
MGNCDNEKMV FISSSTTNEW PQNHPDDQNN ALNMASSAHH VRPTIEKQGQ EQLQQQQQNN  60
QGLALKCPRC DSSNTKFCYY NNYNLSQPRH FCKACKRYWT RGGTLRNVPV GGGCRKNKRV  120
KRPSSGTNSD GSGANSSSSS ANNNFKNHGS VVHQPQTDLC SYSHMMRPLS YGLHINPSSA  180
DMSHVLPFSR FMNSTTSGYD LHDQPHLINA LGLGFSSSAG NINDSTDHNY QNDFSGNTTT  240
TTPKNIQDIV SSNSLFSTYN STFTASTTTP LSSVAGASPT ISSLFSSKFA NGGLKDSRGP  300
MNHFQPLTAP FEDLHIENAS AANCGGVEDL NLSNKEAVKL EDQGQQRRSD WNQTEKIGLS  360
SSDPSFYWNP TVAVGTNW
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015890946.12e-94dof zinc finger protein DOF1.4-like
TrEMBLA0A2P5AMS61e-144A0A2P5AMS6_PARAD; Zinc finger transcription factor
STRINGEOY282027e-89(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45223356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28310.29e-34Dof family protein