PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK26059.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family ARR-B
Protein Properties Length: 594aa    MW: 65258.9 Da    PI: 6.6812
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK26059.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like90.81.2e-28199252155
    G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                kpr++W+ eLH++Fv av+qL G++kA+Pk+ilelm+v+gLt+e+v+SHLQkYRl
  PK26059.1 199 KPRVVWSVELHQQFVGAVNQL-GIDKAVPKKILELMNVPGLTRENVASHLQKYRL 252
                79*******************.********************************8 PP

2Response_reg807.7e-27201281109
                   EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHTTES CS
  Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealkaGak 95 
                   vl+vdD+p+ +++l+++l+   y ev+ +  +e al+ll+e++  +D+++ D+ mp+mdG++ll++i  e  +lp+i+++a + ++ + + +  Ga 
     PK26059.1  20 VLVVDDDPTCLMILEKMLRTCLY-EVTKCNRAEHALNLLRENKngYDVVISDVHMPDMDGFKLLERIGLEM-DLPVIMMSADDGKDVVMKGVTHGAC 114
                   89*********************.***************999999**********************6654.8************************ PP

                   EEEESS--HHHHHH CS
  Response_reg  96 dflsKpfdpeelvk 109
                   d+l Kp+ +e+l +
     PK26059.1 115 DYLIKPVRIEALKN 128
                   **********9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0363928.6E-1791592IPR017053Response regulator B-type, plant
Gene3DG3DSA:3.40.50.23001.5E-4217155No hitNo description
SuperFamilySSF521721.42E-3517138IPR011006CheY-like superfamily
SMARTSM004481.6E-3118130IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011043.65719134IPR001789Signal transduction response regulator, receiver domain
PfamPF000724.5E-2420128IPR001789Signal transduction response regulator, receiver domain
CDDcd001565.33E-2921133No hitNo description
SuperFamilySSF466897.53E-20196256IPR009057Homeodomain-like
PROSITE profilePS512949.894196255IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.5E-30198257IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-24199252IPR006447Myb domain, plants
PfamPF002494.7E-7201251IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009873Biological Processethylene-activated signaling pathway
GO:0010082Biological Processregulation of root meristem growth
GO:0010119Biological Processregulation of stomatal movement
GO:0010150Biological Processleaf senescence
GO:0071368Biological Processcellular response to cytokinin stimulus
GO:0080113Biological Processregulation of seed growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 594 aa     Download sequence    Send to blast
MSTSTSGAGV SDQFPVGLRV LVVDDDPTCL MILEKMLRTC LYEVTKCNRA EHALNLLREN  60
KNGYDVVISD VHMPDMDGFK LLERIGLEMD LPVIMMSADD GKDVVMKGVT HGACDYLIKP  120
VRIEALKNIW QHVVRKKKNE WRGEIEQSGS VEEGDRLAKP SEEPDYSSSA NEGNWRSSKK  180
RKDDEEDGDD RDDSSTLKKP RVVWSVELHQ QFVGAVNQLG IDKAVPKKIL ELMNVPGLTR  240
ENVASHLQKY RLYLRRLSGQ HQTNMNNSFM SPQDPTFGPM TSLNGMDLQT LAVTGQLPAQ  300
SLATLQAAGL GRSTPKSGIP LPIVDQRNLF SFENPKLRFG EGQQQHLSNG KPLNLLHGIP  360
TNMEPKQLTN LHQSAQSLGM NMQVNPHGSQ NSPLLMQMAQ SQSRGPILNE SSSSHASRLP  420
SSVSQPMVTS GVLGRNGISD NGRGAGYNPV MQNSSMLNFP MNHSSELPGN SFPLGNPPSI  480
SGLASKGAFQ EDVNSEIKGS SGFMASYDIF NDLNHHKSND WDIQNVGLTF DASRQSNNLP  540
GSFDMVNQGF SPGQRNLSVR NHSNAGKTIF SMGENDHGTS HNINQNLNPH HGDX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A9e-22198258464ARR10-B
Search in ModeBase