PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK26008.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family MYB
Protein Properties Length: 121aa    MW: 13827 Da    PI: 10.2819
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK26008.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.32.6e-161462148
                     TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd +l+ ++  +G+g +W + ++++g++R++k+c++rw++yl
        PK26008.1 14 KGPWSPEEDTKLKAYIDTYGTGgNWIALPQKIGLKRCGKSCRLRWLNYL 62
                     79**********************************************7 PP

2Myb_DNA-binding40.18.6e-1369111246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g +++eEd ++  +    G++ W+ Ia+ ++ gRt++++k++w++
        PK26008.1  69 GGFSEEEDNIICSLYISIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                      569******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.569962IPR017930Myb domain
SuperFamilySSF466892.34E-2711109IPR009057Homeodomain-like
SMARTSM007176.9E-121364IPR001005SANT/Myb domain
PfamPF002492.6E-151462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.2E-251569IPR009057Homeodomain-like
CDDcd001672.40E-81662No hitNo description
PROSITE profilePS5129421.66663117IPR017930Myb domain
SMARTSM007174.8E-1167115IPR001005SANT/Myb domain
PfamPF002492.0E-1169111IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.5E-2470117IPR009057Homeodomain-like
CDDcd001677.24E-871113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0035987Biological Processendodermal cell differentiation
GO:0045597Biological Processpositive regulation of cell differentiation
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:2000021Biological Processregulation of ion homeostasis
GO:2000067Biological Processregulation of root morphogenesis
GO:0048226Cellular ComponentCasparian strip
GO:0000975Molecular Functionregulatory region DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 121 aa     Download sequence    Send to blast
MGRAPCCDKA NVKKGPWSPE EDTKLKAYID TYGTGGNWIA LPQKIGLKRC GKSCRLRWLN  60
YLRPNIKHGG FSEEEDNIIC SLYISIGSRW SIIAAQLPGR TDNDIKNYWN TRLKKKLLGR  120
R
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-27141177108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008220419.15e-84PREDICTED: transcription factor RAX2-like
RefseqXP_012065305.12e-84PREDICTED: transcription factor RAX3
SwissprotQ9FKL21e-82MYB36_ARATH; Transcription factor MYB36
TrEMBLA0A067L5Z32e-84A0A067L5Z3_JATCU; MYB family protein
STRINGPOPTR_0006s18620.17e-83(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13034340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.19e-84myb domain protein 36