PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK25888.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family Dof
Protein Properties Length: 129aa    MW: 14274.7 Da    PI: 9.9915
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK25888.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1161.5e-36461360
     zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60
                ++lkcprCds+ntkfCyynny+ sqPr+fC++C+r+WtkGG+lrnvPvGggr++++ 
  PK25888.1  4 PEQLKCPRCDSSNTKFCYYNNYNKSQPRHFCRTCKRHWTKGGTLRNVPVGGGRKNKRL 61
               6799***********************************************9776654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-24260IPR003851Zinc finger, Dof-type
PfamPF027013.8E-32659IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.41761IPR003851Zinc finger, Dof-type
PROSITE patternPS013610945IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 129 aa     Download sequence    Send to blast
XPAPEQLKCP RCDSSNTKFC YYNNYNKSQP RHFCRTCKRH WTKGGTLRNV PVGGGRKNKR  60
LKKSSAATAT ATAVAAATAN SDINSTVLFN DDHDQKTISE ILYQAVMVRP PPPPAPEQLK  120
CPRCDSSNX
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). The PEAR proteins (e.g. DOF2.4, DOF5.1, DOF3.2, DOF1.1, DOF5.6 and DOF5.3) activate gene expression that promotes radial growth of protophloem sieve elements (PubMed:30626969). {ECO:0000250|UniProtKB:Q9M2U1, ECO:0000269|PubMed:30626969}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By cytokinin in procambium (PubMed:30626969). Induced by the transcription factor MONOPTEROS (MP) in cells relevant for root initiation, and later in vascular tissues and hypophysis (PubMed:20220754). {ECO:0000269|PubMed:20220754, ECO:0000269|PubMed:30626969}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021599985.17e-42dof zinc finger protein DOF1.4-like
SwissprotQ84TE92e-30DOF53_ARATH; Dof zinc finger protein DOF5.3
TrEMBLA0A3S8TMD12e-44A0A3S8TMD1_BOENI; Dof transcription factor 05
STRINGcassava4.1_034118m3e-41(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF51073356
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G51700.11e-31DOF zinc finger protein 1
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Miyashima S, et al.
    Mobile PEAR transcription factors integrate positional cues to prime cambial growth.
    Nature, 2019. 565(7740): p. 490-494
    [PMID:30626969]