PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK25661.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family SBP
Protein Properties Length: 1052aa    MW: 116612 Da    PI: 8.4103
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK25661.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.71e-40136213178
                --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
        SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                +Cqv++C++dls ak+yhrrhkvCe hsk++++lv++++qrfCqqCsrfh lsefDe+krsCrrrLa+hn+rrrk+q+
  PK25661.1 136 MCQVDNCKEDLSAAKDYHRRHKVCELHSKSTKALVANQMQRFCQQCSRFHPLSEFDEGKRSCRRRLAGHNRRRRKTQP 213
                6**************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.6E-34131198IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.821134211IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.44E-37135215IPR004333Transcription factor, SBP-box
PfamPF031101.4E-29137210IPR004333Transcription factor, SBP-box
CDDcd002043.39E-6812954No hitNo description
Gene3DG3DSA:1.25.40.201.7E-4830954IPR020683Ankyrin repeat-containing domain
SuperFamilySSF484031.03E-6853951IPR020683Ankyrin repeat-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042742Biological Processdefense response to bacterium
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1052 aa     Download sequence    Send to blast
MEEAGAQVAP PIFIHRTLSV MGKKRDLPYQ TPNFQQRFSN PNPVDNWNPK VWEWDTVRFL  60
AKPLDSGSGA ATVNADLAKT EEPSATPVTL KNKTPEVTDA TLRLNLGGGF TSGDEPGSRP  120
NKRVRSGSPG STTYPMCQVD NCKEDLSAAK DYHRRHKVCE LHSKSTKALV ANQMQRFCQQ  180
CSRFHPLSEF DEGKRSCRRR LAGHNRRRRK TQPDDVGSRL LLPGDRDNKT NGHLDIFNLL  240
AAVARAQGKN DDKNMICSPL LDKEQLLQIL SKINSLPLPM DLAAKLHNLA SLSRKIPDQT  300
SSDHYDKLNG RASQSTMDLL AALSATLAPS APDALATLSQ RSSPSSDSGK TKLNCHDQAN  360
SLVLQKRSPQ ELPSLGGDRS STSYQSPMED SDCQAQETRV NLPLQLFSSS PETDSPPKLA  420
SSRKYFSSDS SNPIEERSPS SSPPVMQTLF PMQTMAETVK SEKMSASRET NANVESSRIN  480
ECNMPFDLFR GSNKGTEAAS IQSVPHQAGY TSSGSDHSPS SLNSDVQDRT GRILFKLFDK  540
DPSHFPGTLR TQIFNWLSNS PSEMESYIRP GCVILSVYVS MPSAAWEQLQ ENLLQRLSSL  600
VHSSASDFWR NGRFLVHAGR QLASHKDGKF RLCKSWKTWS SPELISVTPL AVVGGRETSL  660
ILRGRNLSTL GTKIHCTDKG VYTTMEVRVS TNQGTMYEEI SLCGFRTHDA SPSLFGRCFI  720
EVENGFKGNS FPVIIADASI CKELKVLEST FQGERKVSEV IAEDENHDDG RPSSKEEVLH  780
FLNELGWLFQ RKRASSFLNG PCYSLGRFKF LLTFSVERNC SSLIKTLLDI LVERNMDENE  840
LSRETVEMLS EVQLLHRAVK RKCKKMVDLL INYSVIGSDV VSKKYIFPPN HVGPGYITPL  900
HLAACMSSSD EMIDALTNDP QEIGLNSWNS LLDANGQSPY AYAVMTNNQS YNKLVARKLD  960
DRTNGQITVT VGNTMSTEYQ HGSRRSCAKC AAAATKYYRR VPASQGLLQR PYVHSMLAIA  1020
AVCVCVCLFL RGLPDIGAVA PFKWENLDYG TI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A5e-32127210184squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May play a role in plant development. {ECO:0000250, ECO:0000269|PubMed:15703061}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00155DAPTransfer from AT1G20980Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010094493.10.0squamosa promoter-binding-like protein 14
SwissprotQ8RY950.0SPL14_ARATH; Squamosa promoter-binding-like protein 14
TrEMBLA0A2P5DIW90.0A0A2P5DIW9_TREOI; SBP-box transcription factor
STRINGXP_010094493.10.0(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF96943139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20980.10.0squamosa promoter binding protein-like 14
Publications ? help Back to Top
  1. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  2. Liu J, et al.
    Characterizing Variation of Branch Angle and Genome-Wide Association Mapping in Rapeseed (Brassica napus L.).
    Front Plant Sci, 2016. 7: p. 21
    [PMID:26870051]