PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK24670.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family LBD
Protein Properties Length: 83aa    MW: 9370.74 Da    PI: 9.4689
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK24670.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF26089.44.6e-281282171
     DUF260  1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearard 71
               +CaaCk+lr++C++dC+++pyfp+++p++f +vhk+FGasnv k+lk+lp e r +a++++ +eA +r+++
  PK24670.1 12 RCAACKYLRKSCPSDCIFSPYFPSNNPQRFSFVHKVFGASNVGKMLKRLPVELRGEAADTMHFEATCRIEN 82
               6*******************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089119.5711183IPR004883Lateral organ boundaries, LOB
PfamPF031954.1E-281282IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 83 aa     Download sequence    Send to blast
MSSLSSSSHH TRCAACKYLR KSCPSDCIFS PYFPSNNPQR FSFVHKVFGA SNVGKMLKRL  60
PVELRGEAAD TMHFEATCRI ENR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004308220.13e-35PREDICTED: LOB domain-containing protein 24-like
RefseqXP_012848658.13e-35PREDICTED: LOB domain-containing protein 24-like
SwissprotP594671e-31LBD23_ARATH; LOB domain-containing protein 23
SwissprotP594689e-32LBD24_ARATH; LOB domain-containing protein 24
TrEMBLA0A022QJ183e-35A0A022QJ18_ERYGU; Uncharacterized protein (Fragment)
STRINGPOPTR_0012s13910.13e-32(Populus trichocarpa)
STRINGPOPTR_0015s13870.11e-32(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF36973066
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G26660.12e-32LOB domain-containing protein 24