PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK24648.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family NF-YB
Protein Properties Length: 159aa    MW: 16888.6 Da    PI: 4.8217
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK24648.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB186.91.4e-5817112297
      NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 
                reqdrflPianvsrimkk+lPanakiskdaketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGfedyv+plk+yl+k+re+egek
  PK24648.1  17 REQDRFLPIANVSRIMKKALPANAKISKDAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFEDYVDPLKIYLQKFREMEGEK 112
                89********************************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.0E-5414121IPR009072Histone-fold
SuperFamilySSF471134.35E-4119116IPR009072Histone-fold
PfamPF008083.5E-282286IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006157.9E-215068No hitNo description
PROSITE patternPS0068505369IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006157.9E-216987No hitNo description
PRINTSPR006157.9E-2188106No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 159 aa     Download sequence    Send to blast
MADSDNDSGG PNSASPREQD RFLPIANVSR IMKKALPANA KISKDAKETV QECVSEFISF  60
ITGEASDKCQ REKRKTINGD DLLWAMTTLG FEDYVDPLKI YLQKFREMEG EKTAGATLGR  120
GQGGDSGGSD DHGSFAANSG GGGMYGHSSN INSGVQSTG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5g49_A2e-4817107797NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtComponent of the NF-Y/HAP transcription factor complex. {ECO:0000250}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022855621.14e-77nuclear transcription factor Y subunit B-3-like
SwissprotQ75IZ72e-74NFYB8_ORYSJ; Nuclear transcription factor Y subunit B-8
TrEMBLA0A2P5C9A94e-80A0A2P5C9A9_PARAD; Nuclear transcription factor Y subunit B
STRINGLus100225147e-76(Linum usitatissimum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59134150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.13e-75nuclear factor Y, subunit B3
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Kim SK, et al.
    OsNF-YC2 and OsNF-YC4 proteins inhibit flowering under long-day conditions in rice.
    Planta, 2016. 243(3): p. 563-76
    [PMID:26542958]