PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK24360.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family Dof
Protein Properties Length: 129aa    MW: 14405.8 Da    PI: 10.8783
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK24360.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof90.31.6e-282471762
     zf-Dof 17 kfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
               kfCy+nny+++qPr+fCk+CrryWt GG++rnv v +grrknk++s
  PK24360.1  2 KFCYFNNYNVNQPRHFCKNCRRYWTIGGTMRNVHVEAGRRKNKNTS 47
               9******************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088421.968145IPR003851Zinc finger, Dof-type
PfamPF027011.4E-21245IPR003851Zinc finger, Dof-type
ProDomPD0074786.0E-17244IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 129 aa     Download sequence    Send to blast
XKFCYFNNYN VNQPRHFCKN CRRYWTIGGT MRNVHVEAGR RKNKNTSASH YRHIITPDVL  60
QKAQVFATNG VHNTTLGSNG TVLSFGSNSP LCESMASALS LADRRKNSVS TKGFHGPEKR  120
MFVSSGVAX
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Regulates a photoperiodic flowering response. Transcriptional repressor of 'CONSTANS' expression. The stability of CDF2 is controlled by 'GIGANTEA' and redundantly by ADO3, ADO2 and/or ADO1. {ECO:0000250, ECO:0000269|PubMed:19619493}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Circadian-regulation. Highly expressed at the beginning of the light period, then decreases, reaching a minimum between 16 and 29 hours after dawn before rising again at the end of the day. Regulated at the protein level by ADO3 and GI pos-transcriptionally. {ECO:0000269|PubMed:19619493}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010108679.14e-63cyclic dof factor 2
SwissprotQ93ZL51e-31CDF2_ARATH; Cyclic dof factor 2
TrEMBLA0A2P5G0I16e-62A0A2P5G0I1_TREOI; Zinc finger, Dof-type
STRINGXP_010108679.11e-62(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF41453258
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.26e-34cycling DOF factor 2
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]