PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK23777.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family LBD
Protein Properties Length: 160aa    MW: 17263.5 Da    PI: 8.2066
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK23777.2genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.52e-42381371100
     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                +CaaCk+lrr+C+++Cvlapyfp ++p kf ++h++FGasn++k+l+++pe++r da+ss+vyeA+ar+rdPvyG++g i +lq+q+++l+ +la++++e
  PK23777.2  38 PCAACKILRRRCVDKCVLAPYFPPTEPIKFTIAHRVFGASNIIKFLQEIPESQRADAVSSMVYEANARIRDPVYGCAGAICQLQKQVSELQGQLAKAQAE 137
                7***********************************************************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.81337138IPR004883Lateral organ boundaries, LOB
PfamPF031957.1E-4338135IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 160 aa     Download sequence    Send to blast
XLSSPPSSQS SPTSTSNNNV SPTPPPPPPP PPAIVMSPCA ACKILRRRCV DKCVLAPYFP  60
PTEPIKFTIA HRVFGASNII KFLQEIPESQ RADAVSSMVY EANARIRDPV YGCAGAICQL  120
QKQVSELQGQ LAKAQAELVN MQCQQANLIA LICMDVTHLX
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010108453.16e-84hypothetical protein L484_014124
SwissprotQ9LQR04e-71LBD1_ARATH; LOB domain-containing protein 1
TrEMBLW9RZL76e-84W9RZL7_9R
STRINGVIT_13s0019g03700.t013e-80(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.11e-71LOB domain-containing protein 1