PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK23777.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family LBD
Protein Properties Length: 220aa    MW: 23829.7 Da    PI: 6.2245
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK23777.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260134.34.6e-42661651100
     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                +CaaCk+lrr+C+++Cvlapyfp ++p kf ++h++FGasn++k+l+++pe++r da+ss+vyeA+ar+rdPvyG++g i +lq+q+++l+ +la++++e
  PK23777.1  66 PCAACKILRRRCVDKCVLAPYFPPTEPIKFTIAHRVFGASNIIKFLQEIPESQRADAVSSMVYEANARIRDPVYGCAGAICQLQKQVSELQGQLAKAQAE 165
                7***********************************************************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.81365166IPR004883Lateral organ boundaries, LOB
PfamPF031951.6E-4266163IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005739Cellular Componentmitochondrion
Sequence ? help Back to Top
Protein Sequence    Length: 220 aa     Download sequence    Send to blast
XFSSSLPLQQ YSPNNSSSSS PTLNNSSSQL SSPPSSQSSP TSTSNNNVSP TPPPPPPPPP  60
AIVMSPCAAC KILRRRCVDK CVLAPYFPPT EPIKFTIAHR VFGASNIIKF LQEIPESQRA  120
DAVSSMVYEA NARIRDPVYG CAGAICQLQK QVSELQGQLA KAQAELVNMQ CQQANLIALI  180
CMDVTHLQDP PNSHQQPPYV DTACFLDDTT LGTTWEPLWT
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010108453.11e-103hypothetical protein L484_014124
SwissprotQ9LQR01e-73LBD1_ARATH; LOB domain-containing protein 1
TrEMBLW9RZL71e-103W9RZL7_9R
STRINGPOPTR_0008s04350.11e-93(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.18e-74LOB domain-containing protein 1