PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK23763.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family Dof
Protein Properties Length: 351aa    MW: 38214.9 Da    PI: 8.8206
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK23763.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.75.2e-3883143262
     zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                +e alkcprCdstntkfCy+nnysl+qPr+fCk+CrryWt+GGalr vPvGgg+r+nk+++
  PK23763.1  83 PEMALKCPRCDSTNTKFCYFNNYSLTQPRHFCKTCRRYWTRGGALRSVPVGGGCRRNKRTK 143
                67789*****************************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-3667141IPR003851Zinc finger, Dof-type
PfamPF027014.0E-3286141IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.35787141IPR003851Zinc finger, Dof-type
PROSITE patternPS01361089125IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009640Biological Processphotomorphogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MAFSSVPHVY LDPPNWPPQQ PNHNDHQHQQ QQQQQNSNRN DQNSQVHAPL LPTTESVGGG  60
GGAGSIRPGS MADRARLAKI PQPEMALKCP RCDSTNTKFC YFNNYSLTQP RHFCKTCRRY  120
WTRGGALRSV PVGGGCRRNK RTKGSSNRSK SPSTAPTTDR PGSTAAVITS NGSGSSADML  180
GNLGPQQTLP HLPFLPNLHH HLGEYGSGSD IGLNFGGIPP RLGNTGDGDD NIHEFQLNGN  240
GDHQQWRLPQ HQVHQFPFMA SNSEQPTRLS YPFEQFQSKP LETQEVKVEV NNNNNIHNQS  300
GLNNLSRNFL GSLGLNDHQF LGGGGGSSGS GGNINAWTDL STFTSSTNHL I
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00407DAPTransfer from AT3G55370Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_024928012.15e-88dof zinc finger protein DOF3.6-like
TrEMBLA0A2P5C6J01e-118A0A2P5C6J0_PARAD; Zinc finger, Dof-type
STRINGXP_006486095.15e-87(Citrus sinensis)
STRINGXP_006436002.15e-87(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF65634143
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G55370.39e-52OBF-binding protein 3